Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1785
Gene name
Locationscaffold_168:20525..23853
Strand+
Gene length (bp)3328
Transcript length (bp)3222
Coding sequence length (bp)3219
Protein length (aa) 1073

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07993 NAD_binding_4 Male sterility protein 1.9E-26 701 932
PF00501 AMP-binding AMP-binding enzyme 5.7E-26 25 360
PF01370 Epimerase NAD dependent epimerase/dehydratase family 8.9E-09 699 939

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 697 1024 9.0E-16
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 697 1041 4.0E-14
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 387 1016 4.0E-12
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 698 991 2.0E-08
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 649 920 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 697 1024 9.0E-16
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 697 1041 4.0E-14
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 387 1016 4.0E-12
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 698 991 2.0E-08
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 649 920 2.0E-08
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 660 930 4.0E-07
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 692 1003 2.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.6178 0.4876 0.0998 0.1292 0.1327 0.0274 0.0445 0.0674 0.1559 0.2418

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 242 264 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 5 NRPS-like

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup69
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5467
Ophiocordyceps australis 1348a (Ghana) OphauG2|5656
Ophiocordyceps australis 1348a (Ghana) OphauG2|7764
Ophiocordyceps australis map64 (Brazil) OphauB2|1311
Ophiocordyceps australis map64 (Brazil) OphauB2|1430
Ophiocordyceps australis map64 (Brazil) OphauB2|1646
Ophiocordyceps australis map64 (Brazil) OphauB2|4739
Ophiocordyceps camponoti-floridani Ophcf2|01223
Ophiocordyceps camponoti-rufipedis Ophun1|1554
Ophiocordyceps kimflemingae Ophio5|1785 (this protein)
Ophiocordyceps kimflemingae Ophio5|712
Ophiocordyceps subramaniannii Hirsu2|1787
Ophiocordyceps subramaniannii Hirsu2|1856
Ophiocordyceps subramaniannii Hirsu2|4184
Ophiocordyceps subramaniannii Hirsu2|5652
Ophiocordyceps subramaniannii Hirsu2|952

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1785
MPAATEQRYSTGPAYGHRLPVNIVDEVAATDPTRPFVFAPRSNKPEDGWAPITYEQVARAVNHVAHIIAQTVKSG
SEEAFPTLAYVGPNDIRYGIIMLACIKAGCKALFVAPRNSSEIQQSLLEKTACGYFWYAESFHAIVQPWLQLQER
PMQVTMVPSPEKWLSSDPAPFPYSRPFDEARFDPLVTLHTSGSTGTPKPIIVRQGTVAIADEFRNLPEYQDAEFL
WKGWASRSNRMFMPMPLFHTAGLTAFLVVLTIFYGVPLALGIPDQPLSADLVERCLRCSHADSAFLPPSIVEELS
STEKSMDTLKKLNFVGFGGGNLSQAAGDRLVKQGVMLSNGISPTENLPYAIYWQPSPEDWQYFIFNSELMGAVWH
MKDEKEGIYELIISRKDATDPRDQPVFYTFPNATEWSTGDLYRAHPYLPDHWAFHGRADDIIVFSNGEKLNPITI
ENTIMGHPAVKGALVVGQDRFQPALIVEPMHDPKDDQEAKALLEDIWELIDEANRVAVRHGRIVRQLISISDPGI
PFFRASKGTIQRSPTIRAYQKHIDGIYERAEATDMQDVTPLDFTSEETLGNSIIRLINDHVGVQIVETSTDLFSL
GIDSLQVLRISKILGASTGAAGVALDPNVIAPHLVYSNPSPQYLASYLFSASKDVSNAKKEETERETQLLETLIS
KYTKDLPASKAYDKPAPLDDDQTILLTGSTGSLGSYLLERLCTLACVKKILVLNRGQDGGKSRQGSGNEARGLST
DFAKVEFLGTDLSLPDLGLGEAKYGELLVSVDRIIHNAWPVNLNIMSVMPFEPHIRGVRHLVDFSTKAVKRVPIL
FISSIGTASAWQSTKYVPERALEDLSLANTGYGRSKLAASLILDSAVRYAGTAAASVRVGQIAGPRSQKGMWNKQ
EYIPSMIASSLYLGMLPDNFGTGEEVDWMAIEDVTALILDVAGITTNTPVSAIDGYFHSVNPAKTTWGQLAGELL
EYYSGRVRLVSFEEWVTAIEKSASTTTDISRNPAIKLLDLYKGMLQASRQGLSHVNFEMSRTMSRSRTVAQLGPI
TADLLRNWCSQWGFESDAISLQA
Coding >Ophio5|1785
ATGCCTGCTGCAACGGAACAACGATACTCGACCGGACCTGCCTATGGGCATCGGTTGCCTGTCAACATTGTCGAC
GAGGTTGCTGCAACGGACCCTACTCGTCCCTTCGTATTCGCCCCCCGATCTAATAAGCCTGAGGACGGCTGGGCG
CCGATTACATATGAGCAGGTCGCCAGGGCAGTCAACCACGTAGCTCATATCATCGCGCAAACAGTGAAATCGGGT
TCGGAAGAGGCATTCCCTACGTTGGCTTACGTTGGCCCAAATGACATCCGCTACGGAATCATCATGCTCGCTTGT
ATCAAGGCAGGGTGCAAAGCCTTGTTCGTTGCACCTCGGAACAGTTCAGAGATTCAGCAGAGCCTATTGGAGAAG
ACAGCCTGTGGCTACTTCTGGTATGCCGAGTCATTTCATGCCATCGTTCAGCCATGGCTTCAGCTCCAGGAGCGA
CCGATGCAAGTCACTATGGTGCCGTCTCCGGAGAAATGGCTCAGCTCGGATCCGGCCCCGTTTCCTTACTCCCGG
CCGTTCGACGAGGCCCGATTCGATCCGTTGGTGACCCTGCACACCAGCGGCTCGACAGGCACCCCGAAGCCGATC
ATCGTGCGCCAGGGAACTGTTGCCATCGCAGACGAATTTCGAAACCTACCTGAATATCAGGATGCTGAGTTCCTG
TGGAAAGGATGGGCATCTCGTTCCAACCGAATGTTCATGCCCATGCCGCTCTTCCACACCGCTGGCCTCACAGCC
TTCCTCGTGGTCCTTACTATATTTTACGGGGTGCCACTCGCGTTGGGCATACCAGACCAGCCCCTCTCCGCTGAC
TTGGTGGAGAGGTGCCTACGTTGTTCTCATGCCGACTCGGCATTCCTTCCGCCCTCGATTGTGGAGGAACTGAGC
TCGACGGAGAAGAGCATGGATACACTCAAGAAGCTCAACTTTGTTGGCTTCGGTGGCGGAAACCTATCCCAGGCG
GCCGGTGATAGACTTGTGAAGCAGGGGGTCATGCTTTCTAATGGCATCTCGCCAACAGAAAACCTTCCCTATGCC
ATTTACTGGCAGCCTAGTCCCGAGGACTGGCAATACTTCATCTTCAATAGCGAGCTTATGGGGGCGGTTTGGCAC
ATGAAAGACGAGAAAGAAGGCATTTACGAGCTGATCATCTCTCGAAAAGACGCGACGGATCCTCGAGATCAGCCG
GTATTTTACACGTTTCCCAACGCCACCGAGTGGTCAACCGGAGATCTTTACAGAGCCCACCCTTATCTGCCCGAT
CATTGGGCTTTCCACGGCCGGGCCGATGATATCATTGTCTTCTCGAATGGAGAGAAACTTAATCCAATCACAATC
GAAAACACCATCATGGGGCATCCTGCTGTCAAAGGAGCCTTGGTTGTTGGGCAGGATAGGTTTCAACCCGCACTC
ATCGTCGAGCCAATGCATGACCCAAAAGACGACCAAGAGGCAAAGGCATTGCTTGAAGATATATGGGAGCTGATT
GATGAGGCAAACCGGGTGGCGGTCAGGCATGGCCGCATCGTTCGCCAGCTAATTTCCATCTCAGATCCTGGCATC
CCATTCTTTCGGGCGTCAAAGGGTACTATACAGCGAAGTCCAACGATACGAGCCTACCAGAAGCATATTGATGGG
ATTTACGAGCGCGCTGAAGCAACTGACATGCAAGATGTGACGCCACTGGACTTTACCAGCGAAGAAACACTAGGG
AATTCCATCATTCGACTGATAAACGATCATGTTGGGGTGCAGATTGTTGAAACGAGCACAGACTTGTTCTCTCTC
GGCATCGACTCGCTTCAGGTCTTACGGATATCAAAGATACTTGGTGCGAGCACCGGCGCCGCTGGAGTGGCATTG
GATCCCAATGTAATTGCACCTCACTTGGTTTACTCGAACCCGTCACCGCAGTATCTCGCCTCTTACCTCTTCTCG
GCATCCAAGGATGTAAGCAACGCAAAGAAGGAAGAGACTGAGCGGGAGACACAACTACTCGAGACTCTCATATCC
AAGTACACCAAGGATCTCCCCGCCTCAAAGGCATACGATAAGCCCGCACCCCTTGACGATGACCAGACAATTCTT
CTGACGGGCAGTACTGGCTCACTCGGTTCCTACCTTCTCGAAAGACTTTGCACATTGGCGTGCGTCAAGAAGATA
CTTGTTCTCAATCGCGGTCAAGATGGCGGCAAGTCACGTCAAGGCTCTGGCAACGAGGCTCGAGGTTTGAGCACA
GACTTTGCCAAGGTCGAGTTTCTCGGCACCGACCTTTCACTTCCAGATCTAGGTCTCGGTGAGGCAAAGTATGGA
GAGCTTCTCGTGTCGGTGGATCGAATTATCCATAACGCATGGCCCGTCAACCTCAACATCATGAGCGTCATGCCC
TTTGAACCACATATTCGCGGCGTGCGACACTTGGTCGACTTTTCAACCAAGGCCGTTAAGCGCGTCCCTATCCTC
TTCATCTCCAGCATCGGCACAGCAAGCGCTTGGCAATCGACCAAATATGTCCCCGAACGTGCCCTTGAAGACTTG
TCTCTCGCCAATACGGGCTACGGCCGCTCCAAGCTGGCTGCAAGTCTCATTCTGGACTCGGCAGTGCGATACGCC
GGAACCGCTGCCGCGTCGGTCCGAGTGGGACAGATTGCCGGGCCACGAAGCCAGAAGGGCATGTGGAACAAGCAA
GAGTATATACCGAGCATGATTGCCAGCTCTCTCTACCTTGGCATGCTGCCAGACAACTTTGGTACGGGTGAGGAG
GTTGACTGGATGGCCATCGAAGACGTCACCGCTCTCATTCTCGACGTGGCCGGCATAACCACCAACACTCCCGTC
TCAGCCATCGACGGCTACTTCCACAGCGTCAACCCGGCCAAGACAACATGGGGCCAGCTCGCAGGTGAGCTCCTA
GAATACTACTCCGGAAGGGTACGGCTGGTCAGCTTCGAGGAATGGGTTACTGCCATTGAAAAGAGCGCGAGCACC
ACTACGGATATATCGAGAAATCCTGCCATCAAGCTCCTCGACCTGTACAAGGGGATGCTGCAAGCCTCTCGCCAA
GGGCTCAGTCACGTCAATTTCGAAATGTCGAGGACTATGAGCCGCAGCAGGACAGTGGCTCAGCTGGGCCCCATC
ACTGCCGATCTGCTGAGGAATTGGTGCTCTCAGTGGGGGTTTGAGTCCGATGCGATCAGTTTGCAGGCC
Transcript >Ophio5|1785
ATGCCTGCTGCAACGGAACAACGATACTCGACCGGACCTGCCTATGGGCATCGGTTGCCTGTCAACATTGTCGAC
GAGGTTGCTGCAACGGACCCTACTCGTCCCTTCGTATTCGCCCCCCGATCTAATAAGCCTGAGGACGGCTGGGCG
CCGATTACATATGAGCAGGTCGCCAGGGCAGTCAACCACGTAGCTCATATCATCGCGCAAACAGTGAAATCGGGT
TCGGAAGAGGCATTCCCTACGTTGGCTTACGTTGGCCCAAATGACATCCGCTACGGAATCATCATGCTCGCTTGT
ATCAAGGCAGGGTGCAAAGCCTTGTTCGTTGCACCTCGGAACAGTTCAGAGATTCAGCAGAGCCTATTGGAGAAG
ACAGCCTGTGGCTACTTCTGGTATGCCGAGTCATTTCATGCCATCGTTCAGCCATGGCTTCAGCTCCAGGAGCGA
CCGATGCAAGTCACTATGGTGCCGTCTCCGGAGAAATGGCTCAGCTCGGATCCGGCCCCGTTTCCTTACTCCCGG
CCGTTCGACGAGGCCCGATTCGATCCGTTGGTGACCCTGCACACCAGCGGCTCGACAGGCACCCCGAAGCCGATC
ATCGTGCGCCAGGGAACTGTTGCCATCGCAGACGAATTTCGAAACCTACCTGAATATCAGGATGCTGAGTTCCTG
TGGAAAGGATGGGCATCTCGTTCCAACCGAATGTTCATGCCCATGCCGCTCTTCCACACCGCTGGCCTCACAGCC
TTCCTCGTGGTCCTTACTATATTTTACGGGGTGCCACTCGCGTTGGGCATACCAGACCAGCCCCTCTCCGCTGAC
TTGGTGGAGAGGTGCCTACGTTGTTCTCATGCCGACTCGGCATTCCTTCCGCCCTCGATTGTGGAGGAACTGAGC
TCGACGGAGAAGAGCATGGATACACTCAAGAAGCTCAACTTTGTTGGCTTCGGTGGCGGAAACCTATCCCAGGCG
GCCGGTGATAGACTTGTGAAGCAGGGGGTCATGCTTTCTAATGGCATCTCGCCAACAGAAAACCTTCCCTATGCC
ATTTACTGGCAGCCTAGTCCCGAGGACTGGCAATACTTCATCTTCAATAGCGAGCTTATGGGGGCGGTTTGGCAC
ATGAAAGACGAGAAAGAAGGCATTTACGAGCTGATCATCTCTCGAAAAGACGCGACGGATCCTCGAGATCAGCCG
GTATTTTACACGTTTCCCAACGCCACCGAGTGGTCAACCGGAGATCTTTACAGAGCCCACCCTTATCTGCCCGAT
CATTGGGCTTTCCACGGCCGGGCCGATGATATCATTGTCTTCTCGAATGGAGAGAAACTTAATCCAATCACAATC
GAAAACACCATCATGGGGCATCCTGCTGTCAAAGGAGCCTTGGTTGTTGGGCAGGATAGGTTTCAACCCGCACTC
ATCGTCGAGCCAATGCATGACCCAAAAGACGACCAAGAGGCAAAGGCATTGCTTGAAGATATATGGGAGCTGATT
GATGAGGCAAACCGGGTGGCGGTCAGGCATGGCCGCATCGTTCGCCAGCTAATTTCCATCTCAGATCCTGGCATC
CCATTCTTTCGGGCGTCAAAGGGTACTATACAGCGAAGTCCAACGATACGAGCCTACCAGAAGCATATTGATGGG
ATTTACGAGCGCGCTGAAGCAACTGACATGCAAGATGTGACGCCACTGGACTTTACCAGCGAAGAAACACTAGGG
AATTCCATCATTCGACTGATAAACGATCATGTTGGGGTGCAGATTGTTGAAACGAGCACAGACTTGTTCTCTCTC
GGCATCGACTCGCTTCAGGTCTTACGGATATCAAAGATACTTGGTGCGAGCACCGGCGCCGCTGGAGTGGCATTG
GATCCCAATGTAATTGCACCTCACTTGGTTTACTCGAACCCGTCACCGCAGTATCTCGCCTCTTACCTCTTCTCG
GCATCCAAGGATGTAAGCAACGCAAAGAAGGAAGAGACTGAGCGGGAGACACAACTACTCGAGACTCTCATATCC
AAGTACACCAAGGATCTCCCCGCCTCAAAGGCATACGATAAGCCCGCACCCCTTGACGATGACCAGACAATTCTT
CTGACGGGCAGTACTGGCTCACTCGGTTCCTACCTTCTCGAAAGACTTTGCACATTGGCGTGCGTCAAGAAGATA
CTTGTTCTCAATCGCGGTCAAGATGGCGGCAAGTCACGTCAAGGCTCTGGCAACGAGGCTCGAGGTTTGAGCACA
GACTTTGCCAAGGTCGAGTTTCTCGGCACCGACCTTTCACTTCCAGATCTAGGTCTCGGTGAGGCAAAGTATGGA
GAGCTTCTCGTGTCGGTGGATCGAATTATCCATAACGCATGGCCCGTCAACCTCAACATCATGAGCGTCATGCCC
TTTGAACCACATATTCGCGGCGTGCGACACTTGGTCGACTTTTCAACCAAGGCCGTTAAGCGCGTCCCTATCCTC
TTCATCTCCAGCATCGGCACAGCAAGCGCTTGGCAATCGACCAAATATGTCCCCGAACGTGCCCTTGAAGACTTG
TCTCTCGCCAATACGGGCTACGGCCGCTCCAAGCTGGCTGCAAGTCTCATTCTGGACTCGGCAGTGCGATACGCC
GGAACCGCTGCCGCGTCGGTCCGAGTGGGACAGATTGCCGGGCCACGAAGCCAGAAGGGCATGTGGAACAAGCAA
GAGTATATACCGAGCATGATTGCCAGCTCTCTCTACCTTGGCATGCTGCCAGACAACTTTGGTACGGGTGAGGAG
GTTGACTGGATGGCCATCGAAGACGTCACCGCTCTCATTCTCGACGTGGCCGGCATAACCACCAACACTCCCGTC
TCAGCCATCGACGGCTACTTCCACAGCGTCAACCCGGCCAAGACAACATGGGGCCAGCTCGCAGGTGAGCTCCTA
GAATACTACTCCGGAAGGGTACGGCTGGTCAGCTTCGAGGAATGGGTTACTGCCATTGAAAAGAGCGCGAGCACC
ACTACGGATATATCGAGAAATCCTGCCATCAAGCTCCTCGACCTGTACAAGGGGATGCTGCAAGCCTCTCGCCAA
GGGCTCAGTCACGTCAATTTCGAAATGTCGAGGACTATGAGCCGCAGCAGGACAGTGGCTCAGCTGGGCCCCATC
ACTGCCGATCTGCTGAGGAATTGGTGCTCTCAGTGGGGGTTTGAGTCCGATGCGATCAGTTTGCAGGCCTGA
Gene >Ophio5|1785
ATGCCTGCTGCAACGGAACAACGATACTCGACCGGACCTGCCTATGGGCATCGGTTGCCTGTCAACATTGTCGAC
GAGGTTGCTGCAACGGACCCTACTCGTCCCTTCGTATTCGCCCCCCGATCTAATAAGCCTGAGGACGGCTGGGCG
CCGATTACATATGAGCAGGTCGCCAGGGCAGTCAACCACGTAGCTCATATCATCGCGCAAACAGTGAAATCGGGT
TCGGAAGAGGCATTCCCTACGTTGGCTTACGTTGGCCCAAATGACATCCGCTACGGAATCATCATGCTCGCTTGT
ATCAAGGCAGGGTGCAAAGCCTTGTTCGTTGCACCTCGGAACAGTTCAGAGATTCAGCAGAGCCTATTGGAGAAG
ACAGCCTGTGGCTACTTCTGGTATGCCGAGTCATTTCATGCCATCGTTCAGCCATGGCTTCAGCTCCAGGAGCGA
CCGATGCAAGTCACTATGGTGCCGTCTCCGGAGAAATGGCTCAGCTCGGATCCGGCCCCGTTTCCTTACTCCCGG
CCGTTCGACGAGGCCCGATTCGATCCGTTGGTGACCCTGCACACCAGCGGCTCGACAGGCACCCCGAAGCCGATC
ATCGTGCGCCAGGGAACTGTTGCCATCGCAGACGAATTTCGAAACCTACCTGAATATCAGGATGCTGAGTTCCTG
TGGAAAGGATGGGCATCTCGTTCCAACCGAATGTTCATGCCCATGCCGCTCTTCCACACCGCTGGCCTCACAGCC
TTCCTCGTGGTCCTTACTATATTTTACGGGGTGCCACTCGCGTTGGGCATACCAGACCAGCCCCTCTCCGCTGAC
TTGGTGGAGAGGTGCCTACGTTGTTCTCATGCCGACTCGGCATTCCTTCCGCCCTCGATTGTGGAGGAACTGAGC
TCGACGGAGAAGAGCATGGATACACTCAAGAAGCTCAACTTTGTTGGCTTCGGTGGCGGTAGGTACCATCAGACG
TAGATTCCGACATTGGCTGAGGAAAACTGCGCAGGAAACCTATCCCAGGCGGCCGGTGATAGACTTGTGAAGCAG
GGGGTCATGCTTTCTAATGGCATCTCGCCAACAGAGTAAGTACATTGCGAGAAGGCCGCGGACCGTCTAATTGAT
GATGTGTTTCGCCAGAAACCTTCCCTATGCCATTTACTGGCAGCCTAGTCCCGAGGACTGGCAATACTTCATCTT
CAATAGCGAGCTTATGGGGGCGGTTTGGCACATGAAAGACGAGAAAGAAGGCATTTACGAGCTGATCATCTCTCG
AAAAGACGCGACGGATCCTCGAGATCAGCCGGTATTTTACACGTTTCCCAACGCCACCGAGTGGTCAACCGGAGA
TCTTTACAGAGCCCACCCTTATCTGCCCGATCATTGGGCTTTCCACGGCCGGGCCGATGATATCATTGTCTTCTC
GAATGGAGAGAAACTTAATCCAATCACAATCGAAAACACCATCATGGGGCATCCTGCTGTCAAAGGAGCCTTGGT
TGTTGGGCAGGATAGGTTTCAACCCGCACTCATCGTCGAGCCAATGCATGACCCAAAAGACGACCAAGAGGCAAA
GGCATTGCTTGAAGATATATGGGAGCTGATTGATGAGGCAAACCGGGTGGCGGTCAGGCATGGCCGCATCGTTCG
CCAGCTAATTTCCATCTCAGATCCTGGCATCCCATTCTTTCGGGCGTCAAAGGGTACTATACAGCGAAGTCCAAC
GATACGAGCCTACCAGAAGCATATTGATGGGATTTACGAGCGCGCTGAAGCAACTGACATGCAAGATGTGACGCC
ACTGGACTTTACCAGCGAAGAAACACTAGGGAATTCCATCATTCGACTGATAAACGATCATGTTGGGGTGCAGAT
TGTTGAAACGAGCACAGACTTGTTCTCTCTCGGCATCGACTCGCTTCAGGTCTTACGGATATCAAAGATACTTGG
TGCGAGCACCGGCGCCGCTGGAGTGGCATTGGATCCCAATGTAATTGCACCTCACTTGGTTTACTCGAACCCGTC
ACCGCAGTATCTCGCCTCTTACCTCTTCTCGGCATCCAAGGATGTAAGCAACGCAAAGAAGGAAGAGACTGAGCG
GGAGACACAACTACTCGAGACTCTCATATCCAAGTACACCAAGGATCTCCCCGCCTCAAAGGCATACGATAAGCC
CGCACCCCTTGACGATGACCAGACAATTCTTCTGACGGGCAGTACTGGCTCACTCGGTTCCTACCTTCTCGAAAG
ACTTTGCACATTGGCGTGCGTCAAGAAGATACTTGTTCTCAATCGCGGTCAAGATGGCGGCAAGTCACGTCAAGG
CTCTGGCAACGAGGCTCGAGGTTTGAGCACAGACTTTGCCAAGGTCGAGTTTCTCGGCACCGACCTTTCACTTCC
AGATCTAGGTCTCGGTGAGGCAAAGTATGGAGAGCTTCTCGTGTCGGTGGATCGAATTATCCATAACGCATGGCC
CGTCAACCTCAACATCATGAGCGTCATGCCCTTTGAACCACATATTCGCGGCGTGCGACACTTGGTCGACTTTTC
AACCAAGGCCGTTAAGCGCGTCCCTATCCTCTTCATCTCCAGCATCGGCACAGCAAGCGCTTGGCAATCGACCAA
ATATGTCCCCGAACGTGCCCTTGAAGACTTGTCTCTCGCCAATACGGGCTACGGCCGCTCCAAGCTGGCTGCAAG
TCTCATTCTGGACTCGGCAGTGCGATACGCCGGAACCGCTGCCGCGTCGGTCCGAGTGGGACAGATTGCCGGGCC
ACGAAGCCAGAAGGGCATGTGGAACAAGCAAGAGTATATACCGAGCATGATTGCCAGCTCTCTCTACCTTGGCAT
GCTGCCAGACAACTTTGGTACGGGTGAGGAGGTTGACTGGATGGCCATCGAAGACGTCACCGCTCTCATTCTCGA
CGTGGCCGGCATAACCACCAACACTCCCGTCTCAGCCATCGACGGCTACTTCCACAGCGTCAACCCGGCCAAGAC
AACATGGGGCCAGCTCGCAGGTGAGCTCCTAGAATACTACTCCGGAAGGGTACGGCTGGTCAGCTTCGAGGAATG
GGTTACTGCCATTGAAAAGAGCGCGAGCACCACTACGGATATATCGAGAAATCCTGCCATCAAGCTCCTCGACCT
GTACAAGGGGATGCTGCAAGCCTCTCGCCAAGGGCTCAGTCACGTCAATTTCGAAATGTCGAGGACTATGAGCCG
CAGCAGGACAGTGGCTCAGCTGGGCCCCATCACTGCCGATCTGCTGAGGAATTGGTGCTCTCAGTGGGGGTTTGA
GTCCGATGCGATCAGTTTGCAGGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail