Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1783
Gene name
Locationscaffold_168:14947..16402
Strand+
Gene length (bp)1455
Transcript length (bp)1455
Coding sequence length (bp)1452
Protein length (aa) 484

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02458 Transferase Transferase family 1.7E-17 153 472

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9FF86|DCR_ARATH BAHD acyltransferase DCR OS=Arabidopsis thaliana GN=DCR PE=2 SV=1 1 470 1.0E-08
sp|A0PDV5|RAS_PLESU Rosmarinate synthase OS=Plectranthus scutellarioides GN=RAS PE=1 SV=1 162 471 1.0E-08
sp|Q9FI78|HST_ARATH Shikimate O-hydroxycinnamoyltransferase OS=Arabidopsis thaliana GN=HST PE=2 SV=1 153 468 2.0E-08
sp|Q8GSM7|HST_TOBAC Shikimate O-hydroxycinnamoyltransferase OS=Nicotiana tabacum GN=HST PE=1 SV=1 151 468 5.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1783
MKPTLVKLDVPCGEEVIRLSTLDQQAQRNYLKFLLCFELEKTAKVERAIQHVKQGLAVALSEIPDFGSTVVPVPG
SKRKELQLQLDPDSGVPLRVVHHAAANGTFEGQQSPLAGCHYSDLAKDNFPLATIPSEFLFVPHPSCEDECPDGL
AALLVQLNVINGGLILAICWHHSVADAQGMATFLRSWSGHTKTAAAQGFADSPVVSAERDDERWRLSYGTRHATL
TPLSDYSIDATMRAPLNPASPHLLDRLDPRAETATMSTWHFSKESLQSLRSKISEADVDEQFTNSEAVSALVWKH
LSQARQLQDSNPNGTSLFSTRMNYRGRVKQPFHDGFLGNINEPNARTRQNLEDVCAPSTSHSLARLAKLVRDAVV
SLDEKSIKDFIGLVDKLPAVTDLTWSYDTFPGPDLAVTDTSGMDMRQQDWGRHIGYPTSVRLGSREKGVAYILPQ
DRDGGFEVQLQCESEAVERLKTDDVFNTYARFLC
Coding >Ophio5|1783
ATGAAGCCAACATTAGTAAAGCTGGATGTTCCTTGTGGCGAGGAAGTCATCAGACTGTCCACCTTGGACCAGCAG
GCTCAGCGCAACTATCTCAAGTTTCTTCTGTGTTTTGAGTTGGAAAAAACTGCAAAGGTCGAAAGGGCGATACAG
CACGTCAAGCAGGGTTTGGCCGTGGCGCTGAGCGAAATCCCCGACTTTGGCTCTACCGTCGTGCCTGTCCCCGGC
TCTAAGAGAAAGGAACTCCAGCTGCAGTTGGACCCGGATTCGGGAGTGCCGCTGAGAGTTGTTCACCATGCCGCT
GCAAATGGGACCTTTGAAGGCCAACAAAGCCCTTTGGCAGGTTGCCATTACAGCGACTTGGCTAAAGACAACTTC
CCCTTGGCCACCATCCCCAGTGAATTTCTATTTGTTCCGCATCCGAGCTGCGAAGATGAATGCCCGGACGGACTG
GCAGCACTTCTTGTACAGCTCAACGTCATCAACGGCGGACTCATCCTGGCCATCTGCTGGCACCATTCTGTTGCG
GATGCGCAGGGCATGGCGACCTTTCTCCGAAGCTGGTCCGGTCACACGAAGACGGCAGCAGCTCAAGGATTTGCT
GATTCGCCCGTCGTTTCTGCAGAGCGAGATGATGAGAGGTGGCGTCTGTCGTATGGCACTCGCCACGCTACTCTT
ACCCCGTTGTCAGACTACAGCATCGATGCAACCATGCGAGCTCCCCTGAATCCGGCATCGCCGCACTTGCTGGAC
CGTCTGGACCCGAGGGCGGAAACGGCCACGATGAGCACCTGGCACTTTAGCAAGGAATCGCTGCAGTCTCTGCGC
AGCAAGATCAGTGAGGCCGATGTAGATGAGCAGTTCACCAACAGTGAGGCGGTTTCCGCCCTCGTCTGGAAGCAT
CTGAGCCAGGCCCGCCAGCTTCAAGACTCGAATCCCAACGGGACATCTCTCTTTTCTACTCGCATGAACTACCGA
GGGCGCGTCAAGCAGCCATTCCATGATGGCTTCTTGGGCAACATCAACGAACCCAACGCCCGGACTCGCCAGAAT
CTGGAAGACGTCTGCGCACCATCAACGTCGCACTCACTCGCCAGACTGGCAAAGCTAGTTCGCGATGCCGTCGTC
TCGCTCGACGAGAAAAGCATCAAGGACTTCATCGGTCTGGTCGACAAGTTGCCGGCCGTGACCGACTTGACGTGG
AGCTACGATACGTTTCCCGGTCCGGACTTGGCCGTTACCGACACCTCGGGCATGGACATGCGCCAGCAGGACTGG
GGCAGACATATCGGCTATCCGACTTCTGTCCGCTTGGGCTCCCGCGAGAAGGGAGTTGCCTACATCCTGCCGCAG
GATCGAGATGGGGGCTTTGAGGTGCAGCTACAATGCGAGAGCGAAGCGGTTGAGAGGCTGAAAACGGACGACGTC
TTCAACACCTACGCTCGTTTCCTCTGT
Transcript >Ophio5|1783
ATGAAGCCAACATTAGTAAAGCTGGATGTTCCTTGTGGCGAGGAAGTCATCAGACTGTCCACCTTGGACCAGCAG
GCTCAGCGCAACTATCTCAAGTTTCTTCTGTGTTTTGAGTTGGAAAAAACTGCAAAGGTCGAAAGGGCGATACAG
CACGTCAAGCAGGGTTTGGCCGTGGCGCTGAGCGAAATCCCCGACTTTGGCTCTACCGTCGTGCCTGTCCCCGGC
TCTAAGAGAAAGGAACTCCAGCTGCAGTTGGACCCGGATTCGGGAGTGCCGCTGAGAGTTGTTCACCATGCCGCT
GCAAATGGGACCTTTGAAGGCCAACAAAGCCCTTTGGCAGGTTGCCATTACAGCGACTTGGCTAAAGACAACTTC
CCCTTGGCCACCATCCCCAGTGAATTTCTATTTGTTCCGCATCCGAGCTGCGAAGATGAATGCCCGGACGGACTG
GCAGCACTTCTTGTACAGCTCAACGTCATCAACGGCGGACTCATCCTGGCCATCTGCTGGCACCATTCTGTTGCG
GATGCGCAGGGCATGGCGACCTTTCTCCGAAGCTGGTCCGGTCACACGAAGACGGCAGCAGCTCAAGGATTTGCT
GATTCGCCCGTCGTTTCTGCAGAGCGAGATGATGAGAGGTGGCGTCTGTCGTATGGCACTCGCCACGCTACTCTT
ACCCCGTTGTCAGACTACAGCATCGATGCAACCATGCGAGCTCCCCTGAATCCGGCATCGCCGCACTTGCTGGAC
CGTCTGGACCCGAGGGCGGAAACGGCCACGATGAGCACCTGGCACTTTAGCAAGGAATCGCTGCAGTCTCTGCGC
AGCAAGATCAGTGAGGCCGATGTAGATGAGCAGTTCACCAACAGTGAGGCGGTTTCCGCCCTCGTCTGGAAGCAT
CTGAGCCAGGCCCGCCAGCTTCAAGACTCGAATCCCAACGGGACATCTCTCTTTTCTACTCGCATGAACTACCGA
GGGCGCGTCAAGCAGCCATTCCATGATGGCTTCTTGGGCAACATCAACGAACCCAACGCCCGGACTCGCCAGAAT
CTGGAAGACGTCTGCGCACCATCAACGTCGCACTCACTCGCCAGACTGGCAAAGCTAGTTCGCGATGCCGTCGTC
TCGCTCGACGAGAAAAGCATCAAGGACTTCATCGGTCTGGTCGACAAGTTGCCGGCCGTGACCGACTTGACGTGG
AGCTACGATACGTTTCCCGGTCCGGACTTGGCCGTTACCGACACCTCGGGCATGGACATGCGCCAGCAGGACTGG
GGCAGACATATCGGCTATCCGACTTCTGTCCGCTTGGGCTCCCGCGAGAAGGGAGTTGCCTACATCCTGCCGCAG
GATCGAGATGGGGGCTTTGAGGTGCAGCTACAATGCGAGAGCGAAGCGGTTGAGAGGCTGAAAACGGACGACGTC
TTCAACACCTACGCTCGTTTCCTCTGTTGA
Gene >Ophio5|1783
ATGAAGCCAACATTAGTAAAGCTGGATGTTCCTTGTGGCGAGGAAGTCATCAGACTGTCCACCTTGGACCAGCAG
GCTCAGCGCAACTATCTCAAGTTTCTTCTGTGTTTTGAGTTGGAAAAAACTGCAAAGGTCGAAAGGGCGATACAG
CACGTCAAGCAGGGTTTGGCCGTGGCGCTGAGCGAAATCCCCGACTTTGGCTCTACCGTCGTGCCTGTCCCCGGC
TCTAAGAGAAAGGAACTCCAGCTGCAGTTGGACCCGGATTCGGGAGTGCCGCTGAGAGTTGTTCACCATGCCGCT
GCAAATGGGACCTTTGAAGGCCAACAAAGCCCTTTGGCAGGTTGCCATTACAGCGACTTGGCTAAAGACAACTTC
CCCTTGGCCACCATCCCCAGTGAATTTCTATTTGTTCCGCATCCGAGCTGCGAAGATGAATGCCCGGACGGACTG
GCAGCACTTCTTGTACAGCTCAACGTCATCAACGGCGGACTCATCCTGGCCATCTGCTGGCACCATTCTGTTGCG
GATGCGCAGGGCATGGCGACCTTTCTCCGAAGCTGGTCCGGTCACACGAAGACGGCAGCAGCTCAAGGATTTGCT
GATTCGCCCGTCGTTTCTGCAGAGCGAGATGATGAGAGGTGGCGTCTGTCGTATGGCACTCGCCACGCTACTCTT
ACCCCGTTGTCAGACTACAGCATCGATGCAACCATGCGAGCTCCCCTGAATCCGGCATCGCCGCACTTGCTGGAC
CGTCTGGACCCGAGGGCGGAAACGGCCACGATGAGCACCTGGCACTTTAGCAAGGAATCGCTGCAGTCTCTGCGC
AGCAAGATCAGTGAGGCCGATGTAGATGAGCAGTTCACCAACAGTGAGGCGGTTTCCGCCCTCGTCTGGAAGCAT
CTGAGCCAGGCCCGCCAGCTTCAAGACTCGAATCCCAACGGGACATCTCTCTTTTCTACTCGCATGAACTACCGA
GGGCGCGTCAAGCAGCCATTCCATGATGGCTTCTTGGGCAACATCAACGAACCCAACGCCCGGACTCGCCAGAAT
CTGGAAGACGTCTGCGCACCATCAACGTCGCACTCACTCGCCAGACTGGCAAAGCTAGTTCGCGATGCCGTCGTC
TCGCTCGACGAGAAAAGCATCAAGGACTTCATCGGTCTGGTCGACAAGTTGCCGGCCGTGACCGACTTGACGTGG
AGCTACGATACGTTTCCCGGTCCGGACTTGGCCGTTACCGACACCTCGGGCATGGACATGCGCCAGCAGGACTGG
GGCAGACATATCGGCTATCCGACTTCTGTCCGCTTGGGCTCCCGCGAGAAGGGAGTTGCCTACATCCTGCCGCAG
GATCGAGATGGGGGCTTTGAGGTGCAGCTACAATGCGAGAGCGAAGCGGTTGAGAGGCTGAAAACGGACGACGTC
TTCAACACCTACGCTCGTTTCCTCTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail