Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1778
Gene name
Locationscaffold_167:34384..35062
Strand-
Gene length (bp)678
Transcript length (bp)678
Coding sequence length (bp)675
Protein length (aa) 225

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 12.20 3.55 20.84
CcL In ants, during behavior modification 359.92 88.83 631.00
CcD In ants, recently dead 123.28 65.18 181.39

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.002815 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1778
MFPLVVLLLLGSSLLPWTQAKLDLGATIARIDPSTTSCASSGECRTAAQAGALLSTSFSRHGVRCRQEAACLTAL
VLLETDHLKYQHNVYPGRPGQGTANMQMCRFNAEYAASDPVLRKCFPDVLPVGSDPNEDQCRRVLKCILDHEDKS
FDTPAWFWDKKCPDKDARAKLSNGGIEGCAAYLKSCVGVDGNDQSRVALNRKAYDAFEVTNAKTCVPLDQDECQD
Coding >Ophio5|1778
ATGTTTCCCCTCGTCGTCCTCCTCCTTCTCGGTTCCTCTCTCCTCCCTTGGACGCAGGCAAAGCTAGACCTAGGC
GCGACCATCGCCCGCATCGACCCGTCGACAACATCGTGCGCCAGCTCAGGAGAATGCCGGACGGCGGCCCAAGCC
GGTGCCCTCTTGTCCACCTCCTTCTCCCGTCACGGCGTCCGATGTCGTCAGGAAGCCGCCTGTCTCACGGCTCTG
GTCCTTCTCGAGACGGATCATCTCAAATATCAGCACAACGTCTATCCCGGTCGACCGGGTCAGGGAACGGCCAAT
ATGCAAATGTGTCGTTTCAACGCAGAGTACGCGGCTTCGGATCCGGTCCTGCGTAAATGTTTCCCCGATGTCCTC
CCCGTCGGCTCCGATCCGAATGAGGATCAGTGCAGGCGTGTGCTCAAGTGCATCCTCGATCACGAGGATAAGTCT
TTCGATACCCCCGCTTGGTTCTGGGATAAGAAGTGTCCGGATAAGGATGCTCGTGCTAAGCTCAGCAACGGCGGC
ATCGAGGGCTGCGCTGCCTATCTCAAGTCGTGTGTTGGTGTCGATGGCAACGATCAGAGTCGCGTCGCCCTCAAC
CGCAAGGCGTACGATGCCTTCGAGGTGACGAATGCCAAGACTTGTGTTCCCCTCGACCAGGATGAGTGCCAGGAT
Transcript >Ophio5|1778
ATGTTTCCCCTCGTCGTCCTCCTCCTTCTCGGTTCCTCTCTCCTCCCTTGGACGCAGGCAAAGCTAGACCTAGGC
GCGACCATCGCCCGCATCGACCCGTCGACAACATCGTGCGCCAGCTCAGGAGAATGCCGGACGGCGGCCCAAGCC
GGTGCCCTCTTGTCCACCTCCTTCTCCCGTCACGGCGTCCGATGTCGTCAGGAAGCCGCCTGTCTCACGGCTCTG
GTCCTTCTCGAGACGGATCATCTCAAATATCAGCACAACGTCTATCCCGGTCGACCGGGTCAGGGAACGGCCAAT
ATGCAAATGTGTCGTTTCAACGCAGAGTACGCGGCTTCGGATCCGGTCCTGCGTAAATGTTTCCCCGATGTCCTC
CCCGTCGGCTCCGATCCGAATGAGGATCAGTGCAGGCGTGTGCTCAAGTGCATCCTCGATCACGAGGATAAGTCT
TTCGATACCCCCGCTTGGTTCTGGGATAAGAAGTGTCCGGATAAGGATGCTCGTGCTAAGCTCAGCAACGGCGGC
ATCGAGGGCTGCGCTGCCTATCTCAAGTCGTGTGTTGGTGTCGATGGCAACGATCAGAGTCGCGTCGCCCTCAAC
CGCAAGGCGTACGATGCCTTCGAGGTGACGAATGCCAAGACTTGTGTTCCCCTCGACCAGGATGAGTGCCAGGAT
TGA
Gene >Ophio5|1778
ATGTTTCCCCTCGTCGTCCTCCTCCTTCTCGGTTCCTCTCTCCTCCCTTGGACGCAGGCAAAGCTAGACCTAGGC
GCGACCATCGCCCGCATCGACCCGTCGACAACATCGTGCGCCAGCTCAGGAGAATGCCGGACGGCGGCCCAAGCC
GGTGCCCTCTTGTCCACCTCCTTCTCCCGTCACGGCGTCCGATGTCGTCAGGAAGCCGCCTGTCTCACGGCTCTG
GTCCTTCTCGAGACGGATCATCTCAAATATCAGCACAACGTCTATCCCGGTCGACCGGGTCAGGGAACGGCCAAT
ATGCAAATGTGTCGTTTCAACGCAGAGTACGCGGCTTCGGATCCGGTCCTGCGTAAATGTTTCCCCGATGTCCTC
CCCGTCGGCTCCGATCCGAATGAGGATCAGTGCAGGCGTGTGCTCAAGTGCATCCTCGATCACGAGGATAAGTCT
TTCGATACCCCCGCTTGGTTCTGGGATAAGAAGTGTCCGGATAAGGATGCTCGTGCTAAGCTCAGCAACGGCGGC
ATCGAGGGCTGCGCTGCCTATCTCAAGTCGTGTGTTGGTGTCGATGGCAACGATCAGAGTCGCGTCGCCCTCAAC
CGCAAGGCGTACGATGCCTTCGAGGTGACGAATGCCAAGACTTGTGTTCCCCTCGACCAGGATGAGTGCCAGGAT
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail