Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1765
Gene name
Locationscaffold_167:4758..6332
Strand+
Gene length (bp)1574
Transcript length (bp)1470
Coding sequence length (bp)1467
Protein length (aa) 489

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08320 PIG-X PIG-X / PBN1 1.3E-64 263 469

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IBD0|PBN1_GIBZE Protein PBN1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PBN1 PE=3 SV=2 1 472 9.0E-177
sp|Q7RYM7|PBN1_NEUCR Protein pbn1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pbn1 PE=3 SV=1 1 469 4.0E-149
sp|Q2U910|PBN1_ASPOR Protein pbn1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pbn1 PE=3 SV=1 1 489 7.0E-98
sp|Q5BB40|PBN1_EMENI Protein pbn1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pbn1 PE=3 SV=2 1 489 1.0E-96
sp|Q4WU12|PBN1_ASPFU Protein pbn1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pbn1 PE=3 SV=2 1 487 9.0E-91
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IBD0|PBN1_GIBZE Protein PBN1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PBN1 PE=3 SV=2 1 472 9.0E-177
sp|Q7RYM7|PBN1_NEUCR Protein pbn1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pbn1 PE=3 SV=1 1 469 4.0E-149
sp|Q2U910|PBN1_ASPOR Protein pbn1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pbn1 PE=3 SV=1 1 489 7.0E-98
sp|Q5BB40|PBN1_EMENI Protein pbn1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pbn1 PE=3 SV=2 1 489 1.0E-96
sp|Q4WU12|PBN1_ASPFU Protein pbn1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pbn1 PE=3 SV=2 1 487 9.0E-91
sp|Q6C5K1|PBN1_YARLI Protein PBN1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PBN1 PE=3 SV=1 31 489 1.0E-27
sp|P25580|PBN1_YEAST Protein PBN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PBN1 PE=1 SV=1 182 482 6.0E-20
sp|Q6BKZ8|PBN1_DEBHA Protein PBN1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PBN1 PE=3 SV=2 196 477 4.0E-19
sp|Q751U2|PBN1_ASHGO Protein PBN1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PBN1 PE=3 SV=3 121 463 1.0E-17
sp|Q5A4J4|PBN1_CANAL Protein PBN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PBN1 PE=3 SV=1 206 422 2.0E-15
sp|Q6CV11|PBN1_KLULA Protein PBN1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PBN1 PE=3 SV=1 182 469 7.0E-15
sp|Q6FX62|PBN1_CANGA Protein PBN1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PBN1 PE=3 SV=1 1 470 1.0E-13
sp|O94472|PBN1_SCHPO Protein pbn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pbn1 PE=3 SV=1 254 397 6.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0006506 GPI anchor biosynthetic process Yes
GO:0005789 endoplasmic reticulum membrane Yes
GO:0008654 phospholipid biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0043412 macromolecule modification No
GO:1901576 organic substance biosynthetic process No
GO:0006664 glycolipid metabolic process No
GO:0006497 protein lipidation No
GO:0046486 glycerolipid metabolic process No
GO:0006644 phospholipid metabolic process No
GO:0016020 membrane No
GO:0044238 primary metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0009247 glycolipid biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0044255 cellular lipid metabolic process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:0045017 glycerolipid biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0046467 membrane lipid biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0006643 membrane lipid metabolic process No
GO:0110165 cellular anatomical entity No
GO:0019637 organophosphate metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0036211 protein modification process No
GO:0006629 lipid metabolic process No
GO:0005575 cellular_component No
GO:0019538 protein metabolic process No
GO:0031090 organelle membrane No
GO:1903509 liposaccharide metabolic process No
GO:0009987 cellular process No
GO:0006505 GPI anchor metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 449 471 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1765
MRERVTFVHSPDAHVEPSALQLQPAGLVGPATTAIRQDRLTFALNELPLELGSFLRTAGAVHVRWTTAEEHDSLE
PFSSRLSPGLWLSFTPLTDGGPNSVRTLCGLLQAFGPLDCMTPEAFTRAETAASFSLHQRLDDLSALVRWGVHEL
CADTDPICHARTRALYTAASLDISFDSADQLLKVAAFWPLRKQVLTVAASDTRRTEVGVFTKDAPPNMGPLEVGL
GGLLSVMREHKEPSPTLFSFPSRHRASGASFSSEFLAPTGLHPTLQLRLSTNTITADSDAECAPYAYLTLPRTVF
ADRYQLGDKLLLASKNLSALRHSTLPVDLEAPEYATKTWGSSILLELAPPTPRSGQAWTAEVPLHARYVKPTASG
YSELQIPYPAVFWACSSEGTADFSNNPFDRRHVGYDALFGPETTFWHATPRAEVGGRLVSSLTIPTLREDGAAWV
RLGTTVVVGLGFAWVMGRIVAAAWGKGQDKSEAVGKRRR
Coding >Ophio5|1765
ATGCGGGAGCGAGTGACCTTTGTCCACAGCCCAGACGCCCATGTCGAGCCTTCGGCCTTGCAGCTCCAGCCGGCC
GGGCTTGTGGGCCCGGCGACGACGGCGATCCGCCAAGACCGGCTCACCTTTGCCCTGAACGAGCTGCCTCTGGAG
CTGGGCAGCTTCCTACGGACCGCGGGCGCCGTCCACGTGAGGTGGACGACGGCCGAGGAGCACGACTCGTTGGAG
CCATTCAGTTCTCGCCTGTCTCCGGGTCTTTGGCTCTCGTTTACACCGTTGACGGATGGAGGGCCGAACTCGGTG
AGGACGCTGTGCGGACTTCTTCAGGCCTTTGGGCCTTTGGATTGCATGACTCCCGAGGCCTTTACCCGTGCCGAA
ACGGCCGCCTCATTTTCCCTGCACCAAAGGCTGGACGATCTCTCTGCTCTCGTCCGCTGGGGCGTGCACGAATTG
TGCGCAGACACAGATCCCATCTGCCATGCCCGCACGCGCGCCCTGTACACTGCCGCCAGCCTGGACATTTCATTC
GACTCGGCCGACCAGTTGCTCAAGGTGGCCGCCTTCTGGCCCCTGCGGAAGCAAGTCCTGACCGTGGCCGCCTCA
GATACGCGGAGGACTGAGGTGGGCGTCTTCACCAAGGACGCGCCGCCCAACATGGGGCCGCTCGAGGTCGGGCTG
GGAGGGTTACTGAGCGTGATGCGGGAGCACAAAGAGCCTTCCCCGACGCTTTTCTCGTTTCCCTCGCGACACCGA
GCGAGCGGCGCGTCCTTTTCCTCCGAGTTTCTGGCACCGACGGGCCTGCACCCTACGCTGCAGCTGAGGCTGAGC
ACTAACACTATAACTGCCGACTCGGATGCCGAGTGCGCGCCCTACGCCTACCTCACGCTGCCCAGGACCGTCTTC
GCCGACCGGTATCAGTTGGGGGACAAGCTGCTGCTGGCGTCTAAGAACTTGAGCGCGCTGCGGCACTCGACGCTG
CCCGTCGACCTCGAGGCGCCCGAGTACGCGACCAAGACGTGGGGTTCCAGCATCCTCTTGGAACTGGCACCGCCG
ACGCCACGCTCCGGCCAGGCGTGGACGGCCGAGGTGCCGCTCCACGCGCGCTATGTGAAGCCGACGGCGTCTGGA
TACTCGGAGCTGCAGATTCCTTATCCCGCAGTCTTCTGGGCCTGTTCTTCCGAAGGCACGGCCGACTTTTCGAAC
AATCCGTTCGACCGGCGCCACGTGGGCTACGACGCGCTGTTCGGGCCGGAGACGACCTTTTGGCACGCGACGCCC
AGGGCTGAGGTCGGGGGGAGGCTCGTGAGCTCATTGACGATACCGACGCTCAGGGAGGACGGCGCGGCGTGGGTA
AGGCTGGGGACGACGGTTGTGGTGGGCTTGGGATTTGCTTGGGTGATGGGGAGGATTGTGGCTGCTGCTTGGGGA
AAGGGGCAAGATAAGAGCGAGGCTGTTGGGAAACGGCGAAGG
Transcript >Ophio5|1765
ATGCGGGAGCGAGTGACCTTTGTCCACAGCCCAGACGCCCATGTCGAGCCTTCGGCCTTGCAGCTCCAGCCGGCC
GGGCTTGTGGGCCCGGCGACGACGGCGATCCGCCAAGACCGGCTCACCTTTGCCCTGAACGAGCTGCCTCTGGAG
CTGGGCAGCTTCCTACGGACCGCGGGCGCCGTCCACGTGAGGTGGACGACGGCCGAGGAGCACGACTCGTTGGAG
CCATTCAGTTCTCGCCTGTCTCCGGGTCTTTGGCTCTCGTTTACACCGTTGACGGATGGAGGGCCGAACTCGGTG
AGGACGCTGTGCGGACTTCTTCAGGCCTTTGGGCCTTTGGATTGCATGACTCCCGAGGCCTTTACCCGTGCCGAA
ACGGCCGCCTCATTTTCCCTGCACCAAAGGCTGGACGATCTCTCTGCTCTCGTCCGCTGGGGCGTGCACGAATTG
TGCGCAGACACAGATCCCATCTGCCATGCCCGCACGCGCGCCCTGTACACTGCCGCCAGCCTGGACATTTCATTC
GACTCGGCCGACCAGTTGCTCAAGGTGGCCGCCTTCTGGCCCCTGCGGAAGCAAGTCCTGACCGTGGCCGCCTCA
GATACGCGGAGGACTGAGGTGGGCGTCTTCACCAAGGACGCGCCGCCCAACATGGGGCCGCTCGAGGTCGGGCTG
GGAGGGTTACTGAGCGTGATGCGGGAGCACAAAGAGCCTTCCCCGACGCTTTTCTCGTTTCCCTCGCGACACCGA
GCGAGCGGCGCGTCCTTTTCCTCCGAGTTTCTGGCACCGACGGGCCTGCACCCTACGCTGCAGCTGAGGCTGAGC
ACTAACACTATAACTGCCGACTCGGATGCCGAGTGCGCGCCCTACGCCTACCTCACGCTGCCCAGGACCGTCTTC
GCCGACCGGTATCAGTTGGGGGACAAGCTGCTGCTGGCGTCTAAGAACTTGAGCGCGCTGCGGCACTCGACGCTG
CCCGTCGACCTCGAGGCGCCCGAGTACGCGACCAAGACGTGGGGTTCCAGCATCCTCTTGGAACTGGCACCGCCG
ACGCCACGCTCCGGCCAGGCGTGGACGGCCGAGGTGCCGCTCCACGCGCGCTATGTGAAGCCGACGGCGTCTGGA
TACTCGGAGCTGCAGATTCCTTATCCCGCAGTCTTCTGGGCCTGTTCTTCCGAAGGCACGGCCGACTTTTCGAAC
AATCCGTTCGACCGGCGCCACGTGGGCTACGACGCGCTGTTCGGGCCGGAGACGACCTTTTGGCACGCGACGCCC
AGGGCTGAGGTCGGGGGGAGGCTCGTGAGCTCATTGACGATACCGACGCTCAGGGAGGACGGCGCGGCGTGGGTA
AGGCTGGGGACGACGGTTGTGGTGGGCTTGGGATTTGCTTGGGTGATGGGGAGGATTGTGGCTGCTGCTTGGGGA
AAGGGGCAAGATAAGAGCGAGGCTGTTGGGAAACGGCGAAGGTGA
Gene >Ophio5|1765
ATGCGGGAGCGAGTGACCTTTGTCCACAGCCCAGACGCCCATGTCGAGCCTTCGGCCTTGCAGCTCCAGCCGGCC
GGGCTTGTGGGCCCGGCGACGACGGCGATCCGCCAAGACCGGCTCACCTTTGCCCTGAACGAGCTGCCTCTGGAG
CTGGGCAGCTTCCTACGGACCGCGGGCGCCGTCCACGTGAGGTGGACGACGGCCGAGGAGCACGACTCGTTGGAG
CCATTCAGTTCTCGCCTGTCTCCGGGTCTTTGGCTCTCGTTTACACCGTTGACGGATGGAGGGCCGAACTCGTGG
GTTGAATGATAGGAAGATGGGTGGTATATGGTCTCTGACTGAGCACCAGGGTGAGGACGCTGTGCGGACTTCTTC
AGGCCTTTGGGCCTTTGGATTGCATGACTCCCGAGGTGGGTGTCTAGTCTCTCTCTCCGTGTTTCTCTCTCTGAC
TACGAGCATAGGCCTTTACCCGTGCCGAAACGGCCGCCTCATTTTCCCTGCACCAAAGGCTGGACGATCTCTCTG
CTCTCGTCCGCTGGGGCGTGCACGAATTGTGCGCAGACACAGATCCCATCTGCCATGCCCGCACGCGCGCCCTGT
ACACTGCCGCCAGCCTGGACATTTCATTCGACTCGGCCGACCAGTTGCTCAAGGTGGCCGCCTTCTGGCCCCTGC
GGAAGCAAGTCCTGACCGTGGCCGCCTCAGATACGCGGAGGACTGAGGTGGGCGTCTTCACCAAGGACGCGCCGC
CCAACATGGGGCCGCTCGAGGTCGGGCTGGGAGGGTTACTGAGCGTGATGCGGGAGCACAAAGAGCCTTCCCCGA
CGCTTTTCTCGTTTCCCTCGCGACACCGAGCGAGCGGCGCGTCCTTTTCCTCCGAGTTTCTGGCACCGACGGGCC
TGCACCCTACGCTGCAGCTGAGGCTGAGCACTAACACTATAACTGCCGACTCGGATGCCGAGTGCGCGCCCTACG
CCTACCTCACGCTGCCCAGGACCGTCTTCGCCGACCGGTATCAGTTGGGGGACAAGCTGCTGCTGGCGTCTAAGA
ACTTGAGCGCGCTGCGGCACTCGACGCTGCCCGTCGACCTCGAGGCGCCCGAGTACGCGACCAAGACGTGGGGTT
CCAGCATCCTCTTGGAACTGGCACCGCCGACGCCACGCTCCGGCCAGGCGTGGACGGCCGAGGTGCCGCTCCACG
CGCGCTATGTGAAGCCGACGGCGTCTGGATACTCGGAGCTGCAGATTCCTTATCCCGCAGTCTTCTGGGCCTGTT
CTTCCGAAGGCACGGCCGACTTTTCGAACAATCCGTTCGACCGGCGCCACGTGGGCTACGACGCGCTGTTCGGGC
CGGAGACGACCTTTTGGCACGCGACGCCCAGGGCTGAGGTCGGGGGGAGGCTCGTGAGCTCATTGACGATACCGA
CGCTCAGGGAGGACGGCGCGGCGTGGGTAAGGCTGGGGACGACGGTTGTGGTGGGCTTGGGATTTGCTTGGGTGA
TGGGGAGGATTGTGGCTGCTGCTTGGGGAAAGGGGCAAGATAAGAGCGAGGCTGTTGGGAAACGGCGAAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail