© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Ophio5|1760 |
| Gene name | |
| Location | scaffold_166:30474..31524 |
| Strand | + |
| Gene length (bp) | 1050 |
| Transcript length (bp) | 1050 |
| Coding sequence length (bp) | 1047 |
| Protein length (aa) | 349 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF01379 | Porphobil_deam | Porphobilinogen deaminase, dipyromethane cofactor binding domain | 1.4E-78 | 13 | 228 |
| PF03900 | Porphobil_deamC | Porphobilinogen deaminase, C-terminal domain | 1.1E-16 | 242 | 314 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q6MW51|HEM3_NEUCR | Porphobilinogen deaminase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pda-1 PE=3 SV=1 | 6 | 335 | 1.0E-117 |
| sp|Q6C097|HEM3_YARLI | Porphobilinogen deaminase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HEM3 PE=3 SV=1 | 14 | 332 | 1.0E-101 |
| sp|P28789|HEM3_YEAST | Porphobilinogen deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM3 PE=1 SV=1 | 12 | 332 | 1.0E-92 |
| sp|Q6FNR4|HEM3_CANGA | Porphobilinogen deaminase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HEM3 PE=3 SV=1 | 12 | 331 | 2.0E-92 |
| sp|Q6BM23|HEM3_DEBHA | Porphobilinogen deaminase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HEM3 PE=3 SV=1 | 1 | 344 | 3.0E-92 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q6MW51|HEM3_NEUCR | Porphobilinogen deaminase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pda-1 PE=3 SV=1 | 6 | 335 | 1.0E-117 |
| sp|Q6C097|HEM3_YARLI | Porphobilinogen deaminase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HEM3 PE=3 SV=1 | 14 | 332 | 1.0E-101 |
| sp|P28789|HEM3_YEAST | Porphobilinogen deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM3 PE=1 SV=1 | 12 | 332 | 1.0E-92 |
| sp|Q6FNR4|HEM3_CANGA | Porphobilinogen deaminase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HEM3 PE=3 SV=1 | 12 | 331 | 2.0E-92 |
| sp|Q6BM23|HEM3_DEBHA | Porphobilinogen deaminase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HEM3 PE=3 SV=1 | 1 | 344 | 3.0E-92 |
| sp|O94048|HEM3_CANAL | Porphobilinogen deaminase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HEM3 PE=3 SV=1 | 6 | 331 | 1.0E-91 |
| sp|Q75DY0|HEM3_ASHGO | Porphobilinogen deaminase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HEM3 PE=3 SV=1 | 12 | 327 | 1.0E-90 |
| sp|Q6CT60|HEM3_KLULA | Porphobilinogen deaminase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HEM3 PE=3 SV=1 | 14 | 327 | 1.0E-83 |
| sp|Q8YVU6|HEM3_NOSS1 | Porphobilinogen deaminase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hemC PE=3 SV=2 | 5 | 328 | 6.0E-83 |
| sp|A5GSE0|HEM3_SYNR3 | Porphobilinogen deaminase OS=Synechococcus sp. (strain RCC307) GN=hemC PE=3 SV=1 | 12 | 328 | 6.0E-82 |
| sp|P08397|HEM3_HUMAN | Porphobilinogen deaminase OS=Homo sapiens GN=HMBS PE=1 SV=2 | 2 | 324 | 1.0E-80 |
| sp|P22907|HEM3_MOUSE | Porphobilinogen deaminase OS=Mus musculus GN=Hmbs PE=1 SV=2 | 2 | 324 | 4.0E-80 |
| sp|P73660|HEM3_SYNY3 | Porphobilinogen deaminase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hemC PE=3 SV=1 | 14 | 328 | 4.0E-80 |
| sp|Q8DIE4|HEM3_THEEB | Porphobilinogen deaminase OS=Thermosynechococcus elongatus (strain BP-1) GN=hemC PE=3 SV=1 | 14 | 328 | 5.0E-80 |
| sp|A2C0V4|HEM3_PROM1 | Porphobilinogen deaminase OS=Prochlorococcus marinus (strain NATL1A) GN=hemC PE=3 SV=1 | 12 | 326 | 6.0E-80 |
| sp|Q46GS7|HEM3_PROMT | Porphobilinogen deaminase OS=Prochlorococcus marinus (strain NATL2A) GN=hemC PE=3 SV=1 | 12 | 326 | 3.0E-79 |
| sp|P19356|HEM3_RAT | Porphobilinogen deaminase OS=Rattus norvegicus GN=Hmbs PE=1 SV=2 | 2 | 324 | 5.0E-79 |
| sp|Q31C38|HEM3_PROM9 | Porphobilinogen deaminase OS=Prochlorococcus marinus (strain MIT 9312) GN=hemC PE=3 SV=1 | 12 | 326 | 7.0E-79 |
| sp|Q2KIN5|HEM3_BOVIN | Porphobilinogen deaminase OS=Bos taurus GN=HMBS PE=2 SV=1 | 1 | 289 | 8.0E-79 |
| sp|A2BVF7|HEM3_PROM5 | Porphobilinogen deaminase OS=Prochlorococcus marinus (strain MIT 9515) GN=hemC PE=3 SV=1 | 12 | 326 | 9.0E-79 |
| sp|Q31PM2|HEM3_SYNE7 | Porphobilinogen deaminase OS=Synechococcus elongatus (strain PCC 7942) GN=hemC PE=3 SV=1 | 12 | 285 | 1.0E-78 |
| sp|Q3ALS9|HEM3_SYNSC | Porphobilinogen deaminase OS=Synechococcus sp. (strain CC9605) GN=hemC PE=3 SV=1 | 10 | 326 | 2.0E-78 |
| sp|A8G3L1|HEM3_PROM2 | Porphobilinogen deaminase OS=Prochlorococcus marinus (strain MIT 9215) GN=hemC PE=3 SV=1 | 12 | 326 | 3.0E-78 |
| sp|A2BPX7|HEM3_PROMS | Porphobilinogen deaminase OS=Prochlorococcus marinus (strain AS9601) GN=hemC PE=3 SV=1 | 12 | 326 | 4.0E-78 |
| sp|Q7V697|HEM3_PROMM | Porphobilinogen deaminase OS=Prochlorococcus marinus (strain MIT 9313) GN=hemC PE=3 SV=1 | 10 | 329 | 2.0E-77 |
| sp|A3PBM0|HEM3_PROM0 | Porphobilinogen deaminase OS=Prochlorococcus marinus (strain MIT 9301) GN=hemC PE=3 SV=1 | 12 | 326 | 4.0E-77 |
| sp|Q7V2I1|HEM3_PROMP | Porphobilinogen deaminase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=hemC PE=3 SV=1 | 12 | 326 | 4.0E-77 |
| sp|A2C7L8|HEM3_PROM3 | Porphobilinogen deaminase OS=Prochlorococcus marinus (strain MIT 9303) GN=hemC PE=3 SV=1 | 10 | 329 | 2.0E-76 |
| sp|Q7VD89|HEM3_PROMA | Porphobilinogen deaminase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=hemC PE=3 SV=1 | 14 | 326 | 5.0E-76 |
| sp|Q7NGF7|HEM3_GLOVI | Porphobilinogen deaminase OS=Gloeobacter violaceus (strain PCC 7421) GN=hemC PE=3 SV=1 | 12 | 337 | 9.0E-76 |
| sp|Q0I8I3|HEM3_SYNS3 | Porphobilinogen deaminase OS=Synechococcus sp. (strain CC9311) GN=hemC PE=3 SV=1 | 12 | 326 | 1.0E-75 |
| sp|Q09899|HEM3_SCHPO | Porphobilinogen deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hem3 PE=1 SV=2 | 10 | 324 | 7.0E-75 |
| sp|Q7U5C2|HEM3_SYNPX | Porphobilinogen deaminase OS=Synechococcus sp. (strain WH8102) GN=hemC PE=3 SV=1 | 10 | 326 | 2.0E-74 |
| sp|A9BEB6|HEM3_PROM4 | Porphobilinogen deaminase OS=Prochlorococcus marinus (strain MIT 9211) GN=hemC PE=3 SV=1 | 12 | 326 | 2.0E-73 |
| sp|Q65VX7|HEM3_MANSM | Porphobilinogen deaminase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=hemC PE=3 SV=1 | 8 | 326 | 8.0E-73 |
| sp|Q3AWQ4|HEM3_SYNS9 | Porphobilinogen deaminase OS=Synechococcus sp. (strain CC9902) GN=hemC PE=3 SV=1 | 10 | 268 | 1.0E-72 |
| sp|A4IRG5|HEM3_GEOTN | Porphobilinogen deaminase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=hemC PE=3 SV=1 | 12 | 327 | 3.0E-72 |
| sp|Q65GK1|HEM3_BACLD | Porphobilinogen deaminase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=hemC PE=3 SV=1 | 12 | 327 | 5.0E-72 |
| sp|Q54P93|HEM3_DICDI | Porphobilinogen deaminase OS=Dictyostelium discoideum GN=hemC PE=3 SV=1 | 12 | 323 | 2.0E-71 |
| sp|Q5KWK6|HEM3_GEOKA | Porphobilinogen deaminase OS=Geobacillus kaustophilus (strain HTA426) GN=hemC PE=3 SV=1 | 12 | 327 | 3.0E-71 |
| sp|A7Z7A5|HEM3_BACMF | Porphobilinogen deaminase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=hemC PE=3 SV=1 | 12 | 334 | 1.0E-70 |
| sp|Q9K8G0|HEM3_BACHD | Porphobilinogen deaminase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hemC PE=3 SV=1 | 12 | 327 | 2.0E-70 |
| sp|P16616|HEM3_BACSU | Porphobilinogen deaminase OS=Bacillus subtilis (strain 168) GN=hemC PE=3 SV=3 | 12 | 327 | 2.0E-70 |
| sp|C5D5K7|HEM3_GEOSW | Porphobilinogen deaminase OS=Geobacillus sp. (strain WCH70) GN=hemC PE=3 SV=1 | 12 | 327 | 4.0E-70 |
| sp|C0ZAH1|HEM3_BREBN | Porphobilinogen deaminase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=hemC PE=3 SV=1 | 14 | 326 | 7.0E-70 |
| sp|Q5WEP5|HEM3_BACSK | Porphobilinogen deaminase OS=Bacillus clausii (strain KSM-K16) GN=hemC PE=3 SV=1 | 12 | 328 | 8.0E-70 |
| sp|Q8KCJ4|HEM3_CHLTE | Porphobilinogen deaminase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=hemC PE=3 SV=1 | 12 | 330 | 2.0E-69 |
| sp|A6VL87|HEM3_ACTSZ | Porphobilinogen deaminase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=hemC PE=3 SV=1 | 11 | 326 | 4.0E-69 |
| sp|B3EIN1|HEM3_CHLL2 | Porphobilinogen deaminase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=hemC PE=3 SV=1 | 12 | 330 | 2.0E-68 |
| sp|Q4L709|HEM3_STAHJ | Porphobilinogen deaminase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hemC PE=3 SV=1 | 12 | 327 | 3.0E-68 |
| sp|B1I4L8|HEM3_DESAP | Porphobilinogen deaminase OS=Desulforudis audaxviator (strain MP104C) GN=hemC PE=3 SV=1 | 12 | 328 | 4.0E-68 |
| sp|B0UWZ8|HEM3_HISS2 | Porphobilinogen deaminase OS=Histophilus somni (strain 2336) GN=hemC PE=3 SV=1 | 6 | 326 | 7.0E-68 |
| sp|Q0I178|HEM3_HAES1 | Porphobilinogen deaminase OS=Haemophilus somnus (strain 129Pt) GN=hemC PE=3 SV=1 | 6 | 326 | 7.0E-68 |
| sp|B9DNE1|HEM3_STACT | Porphobilinogen deaminase OS=Staphylococcus carnosus (strain TM300) GN=hemC PE=3 SV=1 | 12 | 327 | 1.0E-67 |
| sp|A0LN73|HEM3_SYNFM | Porphobilinogen deaminase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=hemC PE=3 SV=1 | 8 | 329 | 2.0E-67 |
| sp|Q3A009|HEM3_PELCD | Porphobilinogen deaminase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=hemC PE=3 SV=1 | 8 | 331 | 5.0E-67 |
| sp|A8FFV2|HEM3_BACP2 | Porphobilinogen deaminase OS=Bacillus pumilus (strain SAFR-032) GN=hemC PE=3 SV=1 | 12 | 327 | 6.0E-67 |
| sp|A4J6H7|HEM3_DESRM | Porphobilinogen deaminase OS=Desulfotomaculum reducens (strain MI-1) GN=hemC PE=3 SV=1 | 12 | 328 | 1.0E-66 |
| sp|A7GTE5|HEM3_BACCN | Porphobilinogen deaminase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=hemC PE=3 SV=1 | 12 | 327 | 1.0E-66 |
| sp|Q3AQF5|HEM3_CHLCH | Porphobilinogen deaminase OS=Chlorobium chlorochromatii (strain CaD3) GN=hemC PE=3 SV=1 | 12 | 326 | 2.0E-66 |
| sp|Q6GG35|HEM3_STAAR | Porphobilinogen deaminase OS=Staphylococcus aureus (strain MRSA252) GN=hemC PE=3 SV=1 | 12 | 327 | 4.0E-66 |
| sp|A1AUE7|HEM3_PELPD | Porphobilinogen deaminase OS=Pelobacter propionicus (strain DSM 2379) GN=hemC PE=3 SV=1 | 12 | 326 | 6.0E-66 |
| sp|P28464|HEM3_CHLP8 | Porphobilinogen deaminase OS=Chlorobaculum parvum (strain NCIB 8327) GN=hemC PE=3 SV=4 | 12 | 323 | 7.0E-66 |
| sp|A8Z2J1|HEM3_STAAT | Porphobilinogen deaminase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=hemC PE=3 SV=1 | 12 | 327 | 7.0E-66 |
| sp|A6QHK4|HEM3_STAAE | Porphobilinogen deaminase OS=Staphylococcus aureus (strain Newman) GN=hemC PE=3 SV=1 | 12 | 327 | 7.0E-66 |
| sp|Q5HFA2|HEM3_STAAC | Porphobilinogen deaminase OS=Staphylococcus aureus (strain COL) GN=hemC PE=3 SV=1 | 12 | 327 | 7.0E-66 |
| sp|O34090|HEM3_STAA8 | Porphobilinogen deaminase OS=Staphylococcus aureus (strain NCTC 8325) GN=hemC PE=3 SV=1 | 12 | 327 | 7.0E-66 |
| sp|Q2FG66|HEM3_STAA3 | Porphobilinogen deaminase OS=Staphylococcus aureus (strain USA300) GN=hemC PE=3 SV=1 | 12 | 327 | 7.0E-66 |
| sp|P64341|HEM3_STAAN | Porphobilinogen deaminase OS=Staphylococcus aureus (strain N315) GN=hemC PE=1 SV=1 | 12 | 327 | 8.0E-66 |
| sp|P64340|HEM3_STAAM | Porphobilinogen deaminase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hemC PE=3 SV=1 | 12 | 327 | 8.0E-66 |
| sp|A5ITJ5|HEM3_STAA9 | Porphobilinogen deaminase OS=Staphylococcus aureus (strain JH9) GN=hemC PE=3 SV=1 | 12 | 327 | 8.0E-66 |
| sp|A6U2D8|HEM3_STAA2 | Porphobilinogen deaminase OS=Staphylococcus aureus (strain JH1) GN=hemC PE=3 SV=1 | 12 | 327 | 8.0E-66 |
| sp|A7X391|HEM3_STAA1 | Porphobilinogen deaminase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=hemC PE=3 SV=1 | 12 | 327 | 8.0E-66 |
| sp|Q8NW74|HEM3_STAAW | Porphobilinogen deaminase OS=Staphylococcus aureus (strain MW2) GN=hemC PE=3 SV=1 | 12 | 327 | 1.0E-65 |
| sp|Q6G8Q5|HEM3_STAAS | Porphobilinogen deaminase OS=Staphylococcus aureus (strain MSSA476) GN=hemC PE=3 SV=1 | 12 | 327 | 1.0E-65 |
| sp|Q2YTB9|HEM3_STAAB | Porphobilinogen deaminase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=hemC PE=3 SV=1 | 12 | 327 | 2.0E-65 |
| sp|A1BHD6|HEM3_CHLPD | Porphobilinogen deaminase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=hemC PE=3 SV=1 | 12 | 330 | 2.0E-65 |
| sp|A4SFJ8|HEM3_CHLPM | Porphobilinogen deaminase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=hemC PE=3 SV=1 | 12 | 326 | 5.0E-65 |
| sp|Q48AW8|HEM3_COLP3 | Porphobilinogen deaminase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=hemC PE=3 SV=1 | 8 | 326 | 6.0E-65 |
| sp|Q9CK24|HEM3_PASMU | Porphobilinogen deaminase OS=Pasteurella multocida (strain Pm70) GN=hemC PE=3 SV=2 | 12 | 326 | 7.0E-65 |
| sp|Q602K3|HEM3_METCA | Porphobilinogen deaminase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=hemC PE=3 SV=2 | 4 | 328 | 9.0E-65 |
| sp|B8DHJ2|HEM3_LISMH | Porphobilinogen deaminase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=hemC PE=3 SV=1 | 12 | 326 | 1.0E-64 |
| sp|Q3B2Z5|HEM3_CHLL7 | Porphobilinogen deaminase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=hemC PE=3 SV=1 | 12 | 329 | 1.0E-64 |
| sp|B7IIX5|HEM3_BACC2 | Porphobilinogen deaminase OS=Bacillus cereus (strain G9842) GN=hemC PE=3 SV=1 | 12 | 327 | 1.0E-64 |
| sp|Q817R0|HEM3_BACCR | Porphobilinogen deaminase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hemC PE=3 SV=1 | 12 | 327 | 1.0E-64 |
| sp|B7HE96|HEM3_BACC4 | Porphobilinogen deaminase OS=Bacillus cereus (strain B4264) GN=hemC PE=3 SV=1 | 12 | 327 | 1.0E-64 |
| sp|C4K4E3|HEM3_HAMD5 | Porphobilinogen deaminase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=hemC PE=3 SV=1 | 8 | 327 | 1.0E-64 |
| sp|Q8CNY8|HEM3_STAES | Porphobilinogen deaminase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hemC PE=3 SV=1 | 12 | 329 | 2.0E-64 |
| sp|Q5HNN3|HEM3_STAEQ | Porphobilinogen deaminase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=hemC PE=3 SV=1 | 12 | 329 | 2.0E-64 |
| sp|Q6HD62|HEM3_BACHK | Porphobilinogen deaminase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hemC PE=3 SV=1 | 12 | 330 | 2.0E-64 |
| sp|A9VIT8|HEM3_BACWK | Porphobilinogen deaminase OS=Bacillus weihenstephanensis (strain KBAB4) GN=hemC PE=3 SV=1 | 12 | 327 | 5.0E-64 |
| sp|Q633Y0|HEM3_BACCZ | Porphobilinogen deaminase OS=Bacillus cereus (strain ZK / E33L) GN=hemC PE=3 SV=1 | 12 | 330 | 5.0E-64 |
| sp|C1ETR0|HEM3_BACC3 | Porphobilinogen deaminase OS=Bacillus cereus (strain 03BB102) GN=hemC PE=3 SV=1 | 12 | 330 | 9.0E-64 |
| sp|A0RJ81|HEM3_BACAH | Porphobilinogen deaminase OS=Bacillus thuringiensis (strain Al Hakam) GN=hemC PE=3 SV=1 | 12 | 330 | 9.0E-64 |
| sp|B9IZ39|HEM3_BACCQ | Porphobilinogen deaminase OS=Bacillus cereus (strain Q1) GN=hemC PE=3 SV=1 | 12 | 327 | 1.0E-63 |
| sp|B7HQM4|HEM3_BACC7 | Porphobilinogen deaminase OS=Bacillus cereus (strain AH187) GN=hemC PE=3 SV=1 | 12 | 327 | 1.0E-63 |
| sp|B7JQ57|HEM3_BACC0 | Porphobilinogen deaminase OS=Bacillus cereus (strain AH820) GN=hemC PE=3 SV=1 | 12 | 330 | 1.0E-63 |
| sp|A6TJD5|HEM3_ALKMQ | Porphobilinogen deaminase OS=Alkaliphilus metalliredigens (strain QYMF) GN=hemC PE=3 SV=1 | 12 | 327 | 1.0E-63 |
| sp|Q81LC7|HEM3_BACAN | Porphobilinogen deaminase OS=Bacillus anthracis GN=hemC PE=3 SV=1 | 12 | 330 | 1.0E-63 |
| sp|C3L6Z5|HEM3_BACAC | Porphobilinogen deaminase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=hemC PE=3 SV=1 | 12 | 330 | 1.0E-63 |
| sp|C3P9E9|HEM3_BACAA | Porphobilinogen deaminase OS=Bacillus anthracis (strain A0248) GN=hemC PE=3 SV=1 | 12 | 330 | 1.0E-63 |
| sp|Q72ZW2|HEM3_BACC1 | Porphobilinogen deaminase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hemC PE=3 SV=1 | 12 | 330 | 1.0E-63 |
| sp|C1D679|HEM3_LARHH | Porphobilinogen deaminase OS=Laribacter hongkongensis (strain HLHK9) GN=hemC PE=3 SV=1 | 12 | 329 | 2.0E-63 |
| sp|B3QWI1|HEM3_CHLT3 | Porphobilinogen deaminase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=hemC PE=3 SV=1 | 12 | 307 | 3.0E-63 |
| sp|Q8Y6X5|HEM3_LISMO | Porphobilinogen deaminase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=hemC PE=3 SV=1 | 12 | 326 | 5.0E-63 |
| sp|Q088L3|HEM3_SHEFN | Porphobilinogen deaminase OS=Shewanella frigidimarina (strain NCIMB 400) GN=hemC PE=3 SV=1 | 8 | 329 | 5.0E-63 |
| sp|Q49YA2|HEM3_STAS1 | Porphobilinogen deaminase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=hemC PE=3 SV=1 | 12 | 327 | 7.0E-63 |
| sp|B4SFI2|HEM3_PELPB | Porphobilinogen deaminase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=hemC PE=3 SV=1 | 12 | 330 | 2.0E-62 |
| sp|B9E743|HEM3_MACCJ | Porphobilinogen deaminase OS=Macrococcus caseolyticus (strain JCSC5402) GN=hemC PE=3 SV=1 | 12 | 327 | 2.0E-62 |
| sp|B1KQC6|HEM3_SHEWM | Porphobilinogen deaminase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=hemC PE=3 SV=1 | 8 | 326 | 3.0E-62 |
| sp|Q71ZB2|HEM3_LISMF | Porphobilinogen deaminase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=hemC PE=3 SV=1 | 12 | 324 | 6.0E-62 |
| sp|C1KVK3|HEM3_LISMC | Porphobilinogen deaminase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=hemC PE=3 SV=1 | 12 | 324 | 6.0E-62 |
| sp|P0A1Q8|HEM3_SALTY | Porphobilinogen deaminase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=hemC PE=3 SV=1 | 9 | 331 | 6.0E-62 |
| sp|P0A1Q9|HEM3_SALTI | Porphobilinogen deaminase OS=Salmonella typhi GN=hemC PE=3 SV=1 | 9 | 331 | 6.0E-62 |
| sp|B4TNV3|HEM3_SALSV | Porphobilinogen deaminase OS=Salmonella schwarzengrund (strain CVM19633) GN=hemC PE=3 SV=1 | 9 | 331 | 6.0E-62 |
| sp|B5BIU8|HEM3_SALPK | Porphobilinogen deaminase OS=Salmonella paratyphi A (strain AKU_12601) GN=hemC PE=3 SV=1 | 9 | 331 | 6.0E-62 |
| sp|C0Q3B3|HEM3_SALPC | Porphobilinogen deaminase OS=Salmonella paratyphi C (strain RKS4594) GN=hemC PE=3 SV=1 | 9 | 331 | 6.0E-62 |
| sp|Q5PKL7|HEM3_SALPA | Porphobilinogen deaminase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=hemC PE=3 SV=1 | 9 | 331 | 6.0E-62 |
| sp|B5FN93|HEM3_SALDC | Porphobilinogen deaminase OS=Salmonella dublin (strain CT_02021853) GN=hemC PE=3 SV=1 | 9 | 331 | 6.0E-62 |
| sp|B4S922|HEM3_PROA2 | Porphobilinogen deaminase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=hemC PE=3 SV=1 | 12 | 326 | 6.0E-62 |
| sp|Q3ACT3|HEM3_CARHZ | Porphobilinogen deaminase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=hemC PE=3 SV=1 | 12 | 326 | 7.0E-62 |
| sp|A5D3L5|HEM3_PELTS | Porphobilinogen deaminase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=hemC PE=3 SV=1 | 12 | 324 | 7.0E-62 |
| sp|Q8CXC0|HEM3_OCEIH | Porphobilinogen deaminase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=hemC PE=3 SV=1 | 12 | 327 | 7.0E-62 |
| sp|A4TRA8|HEM3_YERPP | Porphobilinogen deaminase OS=Yersinia pestis (strain Pestoides F) GN=hemC PE=3 SV=1 | 9 | 330 | 8.0E-62 |
| sp|Q1CNI3|HEM3_YERPN | Porphobilinogen deaminase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=hemC PE=3 SV=1 | 9 | 330 | 8.0E-62 |
| sp|P46355|HEM3_YERPE | Porphobilinogen deaminase OS=Yersinia pestis GN=hemC PE=3 SV=2 | 9 | 330 | 8.0E-62 |
| sp|Q1CBN1|HEM3_YERPA | Porphobilinogen deaminase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=hemC PE=3 SV=1 | 9 | 330 | 8.0E-62 |
| sp|A7FD67|HEM3_YERP3 | Porphobilinogen deaminase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=hemC PE=3 SV=1 | 9 | 330 | 8.0E-62 |
| sp|Q180R9|HEM3_PEPD6 | Porphobilinogen deaminase OS=Peptoclostridium difficile (strain 630) GN=hemC PE=3 SV=1 | 12 | 262 | 9.0E-62 |
| sp|Q5QUS3|HEM3_IDILO | Porphobilinogen deaminase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=hemC PE=3 SV=1 | 14 | 326 | 1.0E-61 |
| sp|A9MJ10|HEM3_SALAR | Porphobilinogen deaminase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=hemC PE=3 SV=1 | 9 | 326 | 2.0E-61 |
| sp|Q66G00|HEM3_YERPS | Porphobilinogen deaminase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=hemC PE=3 SV=1 | 9 | 330 | 2.0E-61 |
| sp|B2K065|HEM3_YERPB | Porphobilinogen deaminase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=hemC PE=3 SV=1 | 9 | 330 | 2.0E-61 |
| sp|B1JPE6|HEM3_YERPY | Porphobilinogen deaminase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=hemC PE=3 SV=1 | 9 | 330 | 3.0E-61 |
| sp|Q2SQ70|HEM3_HAHCH | Porphobilinogen deaminase OS=Hahella chejuensis (strain KCTC 2396) GN=hemC PE=3 SV=1 | 12 | 326 | 3.0E-61 |
| sp|Q24VC8|HEM3_DESHY | Porphobilinogen deaminase OS=Desulfitobacterium hafniense (strain Y51) GN=hemC PE=3 SV=1 | 12 | 332 | 3.0E-61 |
| sp|B8G2M2|HEM3_DESHD | Porphobilinogen deaminase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=hemC PE=3 SV=1 | 12 | 332 | 3.0E-61 |
| sp|A1WVT9|HEM3_HALHL | Porphobilinogen deaminase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=hemC PE=3 SV=1 | 12 | 326 | 4.0E-61 |
| sp|B1HVD6|HEM3_LYSSC | Porphobilinogen deaminase OS=Lysinibacillus sphaericus (strain C3-41) GN=hemC PE=3 SV=1 | 12 | 317 | 4.0E-61 |
| sp|Q92BF8|HEM3_LISIN | Porphobilinogen deaminase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=hemC PE=3 SV=1 | 12 | 324 | 4.0E-61 |
| sp|Q39QM7|HEM3_GEOMG | Porphobilinogen deaminase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=hemC PE=3 SV=1 | 12 | 326 | 5.0E-61 |
| sp|A9R8K0|HEM3_YERPG | Porphobilinogen deaminase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=hemC PE=3 SV=1 | 9 | 330 | 1.0E-60 |
| sp|A5GCW2|HEM3_GEOUR | Porphobilinogen deaminase OS=Geobacter uraniireducens (strain Rf4) GN=hemC PE=3 SV=1 | 12 | 326 | 1.0E-60 |
| sp|O66621|HEM3_AQUAE | Porphobilinogen deaminase OS=Aquifex aeolicus (strain VF5) GN=hemC PE=3 SV=2 | 12 | 330 | 1.0E-60 |
| sp|Q5ZRY6|HEM3_LEGPH | Porphobilinogen deaminase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=hemC PE=3 SV=2 | 11 | 326 | 1.0E-60 |
| sp|A0AJ05|HEM3_LISW6 | Porphobilinogen deaminase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=hemC PE=3 SV=1 | 12 | 326 | 2.0E-60 |
| sp|Q0AZ43|HEM3_SYNWW | Porphobilinogen deaminase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=hemC PE=3 SV=1 | 12 | 323 | 2.0E-60 |
| sp|A8GZG4|HEM3_SHEPA | Porphobilinogen deaminase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=hemC PE=3 SV=1 | 8 | 328 | 2.0E-60 |
| sp|A8G0W4|HEM3_SHESH | Porphobilinogen deaminase OS=Shewanella sediminis (strain HAW-EB3) GN=hemC PE=3 SV=1 | 8 | 326 | 3.0E-60 |
| sp|B0TJ54|HEM3_SHEHH | Porphobilinogen deaminase OS=Shewanella halifaxensis (strain HAW-EB4) GN=hemC PE=3 SV=1 | 8 | 328 | 5.0E-60 |
| sp|Q6CZG3|HEM3_PECAS | Porphobilinogen deaminase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=hemC PE=3 SV=1 | 10 | 331 | 6.0E-60 |
| sp|Q8E9H0|HEM3_SHEON | Porphobilinogen deaminase OS=Shewanella oneidensis (strain MR-1) GN=hemC PE=3 SV=1 | 12 | 328 | 6.0E-60 |
| sp|Q0VM28|HEM3_ALCBS | Porphobilinogen deaminase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=hemC PE=3 SV=1 | 11 | 328 | 7.0E-60 |
| sp|A1RPD7|HEM3_SHESW | Porphobilinogen deaminase OS=Shewanella sp. (strain W3-18-1) GN=hemC PE=3 SV=1 | 12 | 328 | 9.0E-60 |
| sp|A4YBG2|HEM3_SHEPC | Porphobilinogen deaminase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=hemC PE=3 SV=1 | 12 | 328 | 9.0E-60 |
| sp|C6DHC2|HEM3_PECCP | Porphobilinogen deaminase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=hemC PE=3 SV=1 | 10 | 326 | 1.0E-59 |
| sp|Q0HQI7|HEM3_SHESR | Porphobilinogen deaminase OS=Shewanella sp. (strain MR-7) GN=hemC PE=3 SV=1 | 12 | 328 | 2.0E-59 |
| sp|Q0HN99|HEM3_SHESM | Porphobilinogen deaminase OS=Shewanella sp. (strain MR-4) GN=hemC PE=3 SV=1 | 12 | 328 | 2.0E-59 |
| sp|A0KS60|HEM3_SHESA | Porphobilinogen deaminase OS=Shewanella sp. (strain ANA-3) GN=hemC PE=3 SV=1 | 12 | 328 | 2.0E-59 |
| sp|Q747I1|HEM3_GEOSL | Porphobilinogen deaminase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=hemC PE=3 SV=1 | 12 | 326 | 2.0E-59 |
| sp|Q7P207|HEM3_CHRVO | Porphobilinogen deaminase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=hemC PE=3 SV=2 | 12 | 328 | 3.0E-59 |
| sp|B9M416|HEM3_GEODF | Porphobilinogen deaminase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=hemC PE=3 SV=1 | 12 | 326 | 5.0E-59 |
| sp|A3CL78|HEM3_STRSV | Porphobilinogen deaminase OS=Streptococcus sanguinis (strain SK36) GN=hemC PE=3 SV=1 | 11 | 262 | 5.0E-59 |
| sp|B8E879|HEM3_SHEB2 | Porphobilinogen deaminase OS=Shewanella baltica (strain OS223) GN=hemC PE=3 SV=1 | 12 | 328 | 6.0E-59 |
| sp|B3EPK0|HEM3_CHLPB | Porphobilinogen deaminase OS=Chlorobium phaeobacteroides (strain BS1) GN=hemC PE=3 SV=1 | 12 | 326 | 6.0E-59 |
| sp|A6WTG0|HEM3_SHEB8 | Porphobilinogen deaminase OS=Shewanella baltica (strain OS185) GN=hemC PE=3 SV=1 | 12 | 328 | 7.0E-59 |
| sp|A3D9Q4|HEM3_SHEB5 | Porphobilinogen deaminase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=hemC PE=3 SV=1 | 12 | 328 | 7.0E-59 |
| sp|B2G9H4|HEM3_LACRJ | Porphobilinogen deaminase OS=Lactobacillus reuteri (strain JCM 1112) GN=hemC PE=3 SV=1 | 12 | 325 | 8.0E-59 |
| sp|A5VM67|HEM3_LACRD | Porphobilinogen deaminase OS=Lactobacillus reuteri (strain DSM 20016) GN=hemC PE=3 SV=1 | 12 | 325 | 8.0E-59 |
| sp|B6I4E0|HEM3_ECOSE | Porphobilinogen deaminase OS=Escherichia coli (strain SE11) GN=hemC PE=3 SV=1 | 9 | 326 | 8.0E-59 |
| sp|B7M603|HEM3_ECO8A | Porphobilinogen deaminase OS=Escherichia coli O8 (strain IAI1) GN=hemC PE=3 SV=1 | 9 | 326 | 8.0E-59 |
| sp|B7L959|HEM3_ECO55 | Porphobilinogen deaminase OS=Escherichia coli (strain 55989 / EAEC) GN=hemC PE=3 SV=1 | 9 | 326 | 8.0E-59 |
| sp|A9L5G0|HEM3_SHEB9 | Porphobilinogen deaminase OS=Shewanella baltica (strain OS195) GN=hemC PE=3 SV=1 | 12 | 328 | 1.0E-58 |
| sp|P06983|HEM3_ECOLI | Porphobilinogen deaminase OS=Escherichia coli (strain K12) GN=hemC PE=1 SV=2 | 9 | 326 | 1.0E-58 |
| sp|B1XAH2|HEM3_ECODH | Porphobilinogen deaminase OS=Escherichia coli (strain K12 / DH10B) GN=hemC PE=3 SV=1 | 9 | 326 | 1.0E-58 |
| sp|C4ZZ69|HEM3_ECOBW | Porphobilinogen deaminase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=hemC PE=3 SV=1 | 9 | 326 | 1.0E-58 |
| sp|Q87KI9|HEM3_VIBPA | Porphobilinogen deaminase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hemC PE=3 SV=1 | 10 | 328 | 1.0E-58 |
| sp|Q82WS2|HEM3_NITEU | Porphobilinogen deaminase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=hemC PE=3 SV=1 | 12 | 326 | 1.0E-58 |
| sp|B7LU53|HEM3_ESCF3 | Porphobilinogen deaminase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=hemC PE=3 SV=1 | 9 | 326 | 1.0E-58 |
| sp|Q3SFT5|HEM3_THIDA | Porphobilinogen deaminase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=hemC PE=3 SV=1 | 12 | 328 | 1.0E-58 |
| sp|A8G848|HEM3_SERP5 | Porphobilinogen deaminase OS=Serratia proteamaculans (strain 568) GN=hemC PE=3 SV=1 | 9 | 326 | 1.0E-58 |
| sp|B7NFA7|HEM3_ECOLU | Porphobilinogen deaminase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=hemC PE=3 SV=1 | 9 | 326 | 1.0E-58 |
| sp|Q8XAP3|HEM3_ECO57 | Porphobilinogen deaminase OS=Escherichia coli O157:H7 GN=hemC PE=3 SV=2 | 9 | 326 | 1.0E-58 |
| sp|B7NTE0|HEM3_ECO7I | Porphobilinogen deaminase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=hemC PE=3 SV=1 | 9 | 326 | 1.0E-58 |
| sp|B5FF97|HEM3_VIBFM | Porphobilinogen deaminase OS=Vibrio fischeri (strain MJ11) GN=hemC PE=3 SV=1 | 14 | 328 | 2.0E-58 |
| sp|Q5E8T5|HEM3_VIBF1 | Porphobilinogen deaminase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=hemC PE=3 SV=1 | 14 | 328 | 2.0E-58 |
| sp|Q83PH4|HEM3_SHIFL | Porphobilinogen deaminase OS=Shigella flexneri GN=hemC PE=3 SV=2 | 9 | 326 | 2.0E-58 |
| sp|Q5SLE8|HEM3_THET8 | Porphobilinogen deaminase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=hemC PE=3 SV=1 | 11 | 327 | 2.0E-58 |
| sp|Q72H57|HEM3_THET2 | Porphobilinogen deaminase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hemC PE=3 SV=1 | 11 | 327 | 2.0E-58 |
| sp|Q5X1F2|HEM3_LEGPA | Porphobilinogen deaminase OS=Legionella pneumophila (strain Paris) GN=hemC PE=3 SV=1 | 11 | 326 | 2.0E-58 |
| sp|B7VMD9|HEM3_VIBTL | Porphobilinogen deaminase OS=Vibrio tasmaniensis (strain LGP32) GN=hemC PE=3 SV=1 | 8 | 328 | 2.0E-58 |
| sp|O69110|HEM3_PAEMA | Porphobilinogen deaminase OS=Paenibacillus macerans GN=hemC PE=3 SV=1 | 12 | 262 | 2.0E-58 |
| sp|Q5WT65|HEM3_LEGPL | Porphobilinogen deaminase OS=Legionella pneumophila (strain Lens) GN=hemC PE=3 SV=1 | 11 | 326 | 2.0E-58 |
| sp|Q6FFA9|HEM3_ACIAD | Porphobilinogen deaminase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=hemC PE=3 SV=1 | 12 | 323 | 2.0E-58 |
| sp|Q8FBP1|HEM3_ECOL6 | Porphobilinogen deaminase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hemC PE=3 SV=2 | 9 | 326 | 3.0E-58 |
| sp|Q1LU25|HEM3_BAUCH | Porphobilinogen deaminase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=hemC PE=3 SV=1 | 9 | 323 | 3.0E-58 |
| sp|Q7MQC7|HEM3_VIBVY | Porphobilinogen deaminase OS=Vibrio vulnificus (strain YJ016) GN=hemC PE=3 SV=1 | 8 | 323 | 4.0E-58 |
| sp|Q8DD85|HEM3_VIBVU | Porphobilinogen deaminase OS=Vibrio vulnificus (strain CMCP6) GN=hemC PE=3 SV=1 | 8 | 323 | 4.0E-58 |
| sp|Q9KVM1|HEM3_VIBCH | Porphobilinogen deaminase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hemC PE=3 SV=2 | 8 | 324 | 4.0E-58 |
| sp|B7N295|HEM3_ECO81 | Porphobilinogen deaminase OS=Escherichia coli O81 (strain ED1a) GN=hemC PE=3 SV=1 | 9 | 326 | 4.0E-58 |
| sp|B7MH66|HEM3_ECO45 | Porphobilinogen deaminase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=hemC PE=3 SV=1 | 9 | 326 | 4.0E-58 |
| sp|B6EPK1|HEM3_ALISL | Porphobilinogen deaminase OS=Aliivibrio salmonicida (strain LFI1238) GN=hemC PE=3 SV=1 | 14 | 328 | 4.0E-58 |
| sp|A4WG12|HEM3_ENT38 | Porphobilinogen deaminase OS=Enterobacter sp. (strain 638) GN=hemC PE=3 SV=1 | 9 | 326 | 4.0E-58 |
| sp|B5EBG8|HEM3_GEOBB | Porphobilinogen deaminase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=hemC PE=3 SV=1 | 12 | 326 | 5.0E-58 |
| sp|B5ERN6|HEM3_ACIF5 | Porphobilinogen deaminase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=hemC PE=3 SV=1 | 12 | 292 | 7.0E-58 |
| sp|B7JBH8|HEM3_ACIF2 | Porphobilinogen deaminase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=hemC PE=3 SV=1 | 12 | 292 | 7.0E-58 |
| sp|Q2RJ26|HEM3_MOOTA | Porphobilinogen deaminase OS=Moorella thermoacetica (strain ATCC 39073) GN=hemC PE=3 SV=1 | 12 | 332 | 1.0E-57 |
| sp|B1YJV1|HEM3_EXIS2 | Porphobilinogen deaminase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=hemC PE=3 SV=1 | 12 | 263 | 2.0E-57 |
| sp|A7MXU9|HEM3_VIBCB | Porphobilinogen deaminase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=hemC PE=3 SV=1 | 10 | 328 | 2.0E-57 |
| sp|A1JI86|HEM3_YERE8 | Porphobilinogen deaminase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=hemC PE=3 SV=1 | 9 | 326 | 2.0E-57 |
| sp|B2VG55|HEM3_ERWT9 | Porphobilinogen deaminase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=hemC PE=3 SV=1 | 8 | 326 | 2.0E-57 |
| sp|C6DYY8|HEM3_GEOSM | Porphobilinogen deaminase OS=Geobacter sp. (strain M21) GN=hemC PE=3 SV=1 | 12 | 326 | 2.0E-57 |
| sp|Q1J288|HEM3_DEIGD | Porphobilinogen deaminase OS=Deinococcus geothermalis (strain DSM 11300) GN=hemC PE=3 SV=1 | 12 | 327 | 3.0E-57 |
| sp|Q30S90|HEM3_SULDN | Porphobilinogen deaminase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=hemC PE=3 SV=1 | 12 | 323 | 4.0E-57 |
| sp|A7MQJ1|HEM3_CROS8 | Porphobilinogen deaminase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=hemC PE=3 SV=1 | 9 | 326 | 4.0E-57 |
| sp|Q9RRY0|HEM3_DEIRA | Porphobilinogen deaminase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hemC PE=3 SV=1 | 12 | 326 | 5.0E-57 |
| sp|B4F1X3|HEM3_PROMH | Porphobilinogen deaminase OS=Proteus mirabilis (strain HI4320) GN=hemC PE=3 SV=1 | 8 | 331 | 5.0E-57 |
| sp|Q7VVU9|HEM3_BORPE | Porphobilinogen deaminase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hemC PE=3 SV=1 | 12 | 323 | 9.0E-57 |
| sp|Q02EA3|HEM3_PSEAB | Porphobilinogen deaminase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=hemC PE=3 SV=1 | 12 | 333 | 9.0E-57 |
| sp|Q59684|HEM3_PROMI | Porphobilinogen deaminase OS=Proteus mirabilis GN=hemC PE=3 SV=1 | 10 | 331 | 1.0E-56 |
| sp|Q1I316|HEM3_PSEE4 | Porphobilinogen deaminase OS=Pseudomonas entomophila (strain L48) GN=hemC PE=3 SV=1 | 12 | 333 | 1.0E-56 |
| sp|A6Q3S1|HEM3_NITSB | Porphobilinogen deaminase OS=Nitratiruptor sp. (strain SB155-2) GN=hemC PE=3 SV=1 | 12 | 332 | 1.0E-56 |
| sp|Q60169|HEM3_PSEAE | Porphobilinogen deaminase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hemC PE=3 SV=2 | 12 | 333 | 1.0E-56 |
| sp|B7V5F0|HEM3_PSEA8 | Porphobilinogen deaminase OS=Pseudomonas aeruginosa (strain LESB58) GN=hemC PE=3 SV=1 | 12 | 333 | 1.0E-56 |
| sp|A1T0R0|HEM3_PSYIN | Porphobilinogen deaminase OS=Psychromonas ingrahamii (strain 37) GN=hemC PE=3 SV=1 | 12 | 326 | 2.0E-56 |
| sp|Q3K4T0|HEM3_PSEPF | Porphobilinogen deaminase OS=Pseudomonas fluorescens (strain Pf0-1) GN=hemC PE=3 SV=1 | 12 | 326 | 2.0E-56 |
| sp|B8GSU8|HEM3_THISH | Porphobilinogen deaminase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=hemC PE=3 SV=1 | 12 | 323 | 3.0E-56 |
| sp|B2JEN9|HEM3_BURP8 | Porphobilinogen deaminase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=hemC PE=3 SV=1 | 12 | 337 | 3.0E-56 |
| sp|A6TGI8|HEM3_KLEP7 | Porphobilinogen deaminase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hemC PE=3 SV=1 | 9 | 326 | 4.0E-56 |
| sp|Q1GXA1|HEM3_METFK | Porphobilinogen deaminase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=hemC PE=3 SV=1 | 12 | 326 | 8.0E-56 |
| sp|Q7W785|HEM3_BORPA | Porphobilinogen deaminase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hemC PE=3 SV=1 | 12 | 323 | 1.0E-55 |
| sp|Q7WKM1|HEM3_BORBR | Porphobilinogen deaminase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hemC PE=3 SV=1 | 12 | 323 | 1.0E-55 |
| sp|Q15Z15|HEM3_PSEA6 | Porphobilinogen deaminase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=hemC PE=3 SV=1 | 8 | 326 | 1.0E-55 |
| sp|B5XYL1|HEM3_KLEP3 | Porphobilinogen deaminase OS=Klebsiella pneumoniae (strain 342) GN=hemC PE=3 SV=1 | 9 | 326 | 1.0E-55 |
| sp|A9FDP9|HEM3_SORC5 | Porphobilinogen deaminase OS=Sorangium cellulosum (strain So ce56) GN=hemC PE=3 SV=1 | 10 | 262 | 2.0E-55 |
| sp|Q31JG5|HEM3_THICR | Porphobilinogen deaminase OS=Thiomicrospira crunogena (strain XCL-2) GN=hemC PE=3 SV=1 | 12 | 326 | 3.0E-55 |
| sp|A5CW34|HEM3_VESOH | Porphobilinogen deaminase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=hemC PE=3 SV=1 | 12 | 324 | 3.0E-55 |
| sp|C4L4J6|HEM3_EXISA | Porphobilinogen deaminase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=hemC PE=3 SV=1 | 12 | 327 | 4.0E-55 |
| sp|B0KH05|HEM3_PSEPG | Porphobilinogen deaminase OS=Pseudomonas putida (strain GB-1) GN=hemC PE=3 SV=1 | 12 | 333 | 4.0E-55 |
| sp|A1TXW9|HEM3_MARHV | Porphobilinogen deaminase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=hemC PE=3 SV=1 | 12 | 326 | 5.0E-55 |
| sp|Q8XWW3|HEM3_RALSO | Porphobilinogen deaminase OS=Ralstonia solanacearum (strain GMI1000) GN=hemC PE=3 SV=1 | 2 | 328 | 6.0E-55 |
| sp|Q7MYN1|HEM3_PHOLL | Porphobilinogen deaminase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hemC PE=3 SV=1 | 12 | 326 | 6.0E-55 |
| sp|P13446|HEM3_EUGGR | Porphobilinogen deaminase, chloroplastic OS=Euglena gracilis PE=1 SV=1 | 14 | 331 | 9.0E-55 |
| sp|Q43082|HEM3_PEA | Porphobilinogen deaminase, chloroplastic OS=Pisum sativum GN=HEMC PE=1 SV=1 | 3 | 317 | 1.0E-54 |
| sp|B2T1D1|HEM3_BURPP | Porphobilinogen deaminase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=hemC PE=3 SV=1 | 12 | 349 | 2.0E-54 |
| sp|Q500N6|HEM3_PSEU2 | Porphobilinogen deaminase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=hemC PE=3 SV=1 | 12 | 326 | 4.0E-54 |
| sp|A9IKF3|HEM3_BORPD | Porphobilinogen deaminase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=hemC PE=3 SV=1 | 12 | 323 | 4.0E-54 |
| sp|A6VE37|HEM3_PSEA7 | Porphobilinogen deaminase OS=Pseudomonas aeruginosa (strain PA7) GN=hemC PE=3 SV=1 | 12 | 333 | 5.0E-54 |
| sp|Q88B91|HEM3_PSESM | Porphobilinogen deaminase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=hemC PE=3 SV=1 | 12 | 326 | 5.0E-54 |
| sp|Q21XQ9|HEM3_RHOFT | Porphobilinogen deaminase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=hemC PE=3 SV=1 | 10 | 314 | 5.0E-54 |
| sp|Q98EI7|HEM3_RHILO | Porphobilinogen deaminase OS=Rhizobium loti (strain MAFF303099) GN=hemC PE=3 SV=1 | 10 | 324 | 6.0E-54 |
| sp|Q9JVS4|HEM3_NEIMA | Porphobilinogen deaminase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=hemC PE=3 SV=1 | 8 | 326 | 6.0E-54 |
| sp|Q9K0P6|HEM3_NEIMB | Porphobilinogen deaminase OS=Neisseria meningitidis serogroup B (strain MC58) GN=hemC PE=3 SV=1 | 8 | 326 | 6.0E-54 |
| sp|A1AX51|HEM3_RUTMC | Porphobilinogen deaminase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=hemC PE=3 SV=1 | 12 | 324 | 7.0E-54 |
| sp|Q1D8Z8|HEM3_MYXXD | Porphobilinogen deaminase OS=Myxococcus xanthus (strain DK 1622) GN=hemC PE=3 SV=1 | 10 | 323 | 1.0E-53 |
| sp|B1J1V2|HEM3_PSEPW | Porphobilinogen deaminase OS=Pseudomonas putida (strain W619) GN=hemC PE=3 SV=1 | 12 | 333 | 1.0E-53 |
| sp|C3K424|HEM3_PSEFS | Porphobilinogen deaminase OS=Pseudomonas fluorescens (strain SBW25) GN=hemC PE=3 SV=1 | 12 | 326 | 1.0E-53 |
| sp|B3E2H7|HEM3_GEOLS | Porphobilinogen deaminase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=hemC PE=3 SV=1 | 12 | 326 | 2.0E-53 |
| sp|A8ERI4|HEM3_ARCB4 | Porphobilinogen deaminase OS=Arcobacter butzleri (strain RM4018) GN=hemC PE=3 SV=1 | 12 | 324 | 2.0E-53 |
| sp|Q43316|HEM3_ARATH | Porphobilinogen deaminase, chloroplastic OS=Arabidopsis thaliana GN=HEMC PE=1 SV=1 | 11 | 317 | 2.0E-53 |
| sp|C1CYD9|HEM3_DEIDV | Porphobilinogen deaminase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=hemC PE=3 SV=1 | 12 | 325 | 5.0E-53 |
| sp|A7NKU8|HEM3_ROSCS | Porphobilinogen deaminase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=hemC PE=3 SV=1 | 12 | 263 | 6.0E-53 |
| sp|A0LRF1|HEM3_ACIC1 | Porphobilinogen deaminase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=hemC PE=3 SV=1 | 5 | 325 | 6.0E-53 |
| sp|Q6H6D2|HEM3_ORYSJ | Porphobilinogen deaminase, chloroplastic OS=Oryza sativa subsp. japonica GN=HEMC PE=2 SV=1 | 10 | 327 | 7.0E-53 |
| sp|A7I1S0|HEM3_CAMHC | Porphobilinogen deaminase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=hemC PE=3 SV=1 | 12 | 324 | 1.0E-52 |
| sp|Q8RFP5|HEM3_FUSNN | Porphobilinogen deaminase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=hemC PE=3 SV=1 | 12 | 281 | 1.0E-52 |
| sp|Q4K3X3|HEM3_PSEF5 | Porphobilinogen deaminase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hemC PE=3 SV=1 | 12 | 326 | 1.0E-52 |
| sp|Q47LA7|HEM3_THEFY | Porphobilinogen deaminase OS=Thermobifida fusca (strain YX) GN=hemC PE=3 SV=1 | 14 | 330 | 3.0E-52 |
| sp|A0Q2B1|HEM3_CLONN | Porphobilinogen deaminase OS=Clostridium novyi (strain NT) GN=hemC PE=3 SV=1 | 12 | 263 | 4.0E-52 |
| sp|Q0BP15|HEM3_FRATO | Porphobilinogen deaminase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=hemC PE=3 SV=1 | 12 | 325 | 9.0E-52 |
| sp|B2SE34|HEM3_FRATM | Porphobilinogen deaminase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=hemC PE=3 SV=1 | 12 | 325 | 1.0E-51 |
| sp|Q2A5R3|HEM3_FRATH | Porphobilinogen deaminase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=hemC PE=3 SV=1 | 12 | 325 | 1.0E-51 |
| sp|A7N9H6|HEM3_FRATF | Porphobilinogen deaminase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=hemC PE=3 SV=1 | 12 | 325 | 1.0E-51 |
| sp|A5VWX3|HEM3_PSEP1 | Porphobilinogen deaminase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=hemC PE=3 SV=1 | 12 | 333 | 1.0E-51 |
| sp|Q3BXV3|HEM3_XANC5 | Porphobilinogen deaminase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=hemC PE=3 SV=1 | 10 | 323 | 1.0E-51 |
| sp|Q5NI31|HEM3_FRATT | Porphobilinogen deaminase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=hemC PE=3 SV=1 | 12 | 325 | 1.0E-51 |
| sp|Q14JI3|HEM3_FRAT1 | Porphobilinogen deaminase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=hemC PE=3 SV=1 | 12 | 325 | 1.0E-51 |
| sp|A5UU37|HEM3_ROSS1 | Porphobilinogen deaminase OS=Roseiflexus sp. (strain RS-1) GN=hemC PE=3 SV=1 | 12 | 263 | 1.0E-51 |
| sp|A4IZY4|HEM3_FRATW | Porphobilinogen deaminase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=hemC PE=3 SV=1 | 12 | 325 | 1.0E-51 |
| sp|A9KDC4|HEM3_COXBN | Porphobilinogen deaminase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=hemC PE=3 SV=1 | 12 | 323 | 1.0E-51 |
| sp|B6J6K0|HEM3_COXB1 | Porphobilinogen deaminase OS=Coxiella burnetii (strain CbuK_Q154) GN=hemC PE=3 SV=1 | 12 | 323 | 1.0E-51 |
| sp|Q88RE5|HEM3_PSEPK | Porphobilinogen deaminase OS=Pseudomonas putida (strain KT2440) GN=hemC PE=3 SV=1 | 12 | 333 | 1.0E-51 |
| sp|B2A1G7|HEM3_NATTJ | Porphobilinogen deaminase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=hemC PE=3 SV=1 | 12 | 323 | 2.0E-51 |
| sp|Q83A37|HEM3_COXBU | Porphobilinogen deaminase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=hemC PE=3 SV=1 | 12 | 323 | 2.0E-51 |
| sp|B6J3T6|HEM3_COXB2 | Porphobilinogen deaminase OS=Coxiella burnetii (strain CbuG_Q212) GN=hemC PE=3 SV=1 | 12 | 323 | 2.0E-51 |
| sp|Q0A577|HEM3_ALKEH | Porphobilinogen deaminase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=hemC PE=3 SV=1 | 12 | 323 | 3.0E-51 |
| sp|Q1INI6|HEM3_KORVE | Porphobilinogen deaminase OS=Koribacter versatilis (strain Ellin345) GN=hemC PE=3 SV=1 | 12 | 326 | 5.0E-51 |
| sp|A9N910|HEM3_COXBR | Porphobilinogen deaminase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=hemC PE=3 SV=1 | 12 | 323 | 6.0E-51 |
| sp|A0Q481|HEM3_FRATN | Porphobilinogen deaminase OS=Francisella tularensis subsp. novicida (strain U112) GN=hemC PE=3 SV=1 | 12 | 325 | 6.0E-51 |
| sp|A7GYU4|HEM3_CAMC5 | Porphobilinogen deaminase OS=Campylobacter curvus (strain 525.92) GN=hemC PE=3 SV=1 | 11 | 324 | 1.0E-50 |
| sp|Q1QQP5|HEM3_NITHX | Porphobilinogen deaminase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=hemC PE=3 SV=1 | 3 | 290 | 1.0E-50 |
| sp|B0RNI9|HEM3_XANCB | Porphobilinogen deaminase OS=Xanthomonas campestris pv. campestris (strain B100) GN=hemC PE=3 SV=1 | 10 | 323 | 1.0E-50 |
| sp|Q68WR3|HEM3_RICTY | Porphobilinogen deaminase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=hemC PE=3 SV=1 | 14 | 270 | 1.0E-50 |
| sp|Q8YJB0|HEM3_BRUME | Porphobilinogen deaminase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=hemC PE=3 SV=2 | 6 | 312 | 1.0E-50 |
| sp|C0RFD1|HEM3_BRUMB | Porphobilinogen deaminase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=hemC PE=3 SV=1 | 6 | 312 | 1.0E-50 |
| sp|Q57B08|HEM3_BRUAB | Porphobilinogen deaminase OS=Brucella abortus biovar 1 (strain 9-941) GN=hemC PE=3 SV=1 | 6 | 312 | 1.0E-50 |
| sp|Q2YLM5|HEM3_BRUA2 | Porphobilinogen deaminase OS=Brucella abortus (strain 2308) GN=hemC PE=3 SV=1 | 6 | 312 | 1.0E-50 |
| sp|B2S842|HEM3_BRUA1 | Porphobilinogen deaminase OS=Brucella abortus (strain S19) GN=hemC PE=3 SV=1 | 6 | 312 | 1.0E-50 |
| sp|A5VSL5|HEM3_BRUO2 | Porphobilinogen deaminase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=hemC PE=3 SV=1 | 12 | 312 | 1.0E-50 |
| sp|Q479S8|HEM3_DECAR | Porphobilinogen deaminase OS=Dechloromonas aromatica (strain RCB) GN=hemC PE=3 SV=1 | 12 | 324 | 2.0E-50 |
| sp|C4Z552|HEM3_EUBE2 | Porphobilinogen deaminase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=hemC PE=3 SV=1 | 14 | 304 | 2.0E-50 |
| sp|B0TW04|HEM3_FRAP2 | Porphobilinogen deaminase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=hemC PE=3 SV=1 | 12 | 324 | 2.0E-50 |
| sp|B2SMV3|HEM3_XANOP | Porphobilinogen deaminase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=hemC PE=3 SV=1 | 10 | 326 | 2.0E-50 |
| sp|Q2NYU4|HEM3_XANOM | Porphobilinogen deaminase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=hemC PE=3 SV=1 | 10 | 326 | 2.0E-50 |
| sp|A5EW83|HEM3_DICNV | Porphobilinogen deaminase OS=Dichelobacter nodosus (strain VCS1703A) GN=hemC PE=3 SV=1 | 12 | 324 | 3.0E-50 |
| sp|Q3SVF3|HEM3_NITWN | Porphobilinogen deaminase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=hemC PE=3 SV=1 | 3 | 287 | 3.0E-50 |
| sp|A8GNR5|HEM3_RICAH | Porphobilinogen deaminase OS=Rickettsia akari (strain Hartford) GN=hemC PE=3 SV=1 | 14 | 317 | 3.0E-50 |
| sp|Q8FYI6|HEM3_BRUSU | Porphobilinogen deaminase OS=Brucella suis biovar 1 (strain 1330) GN=hemC PE=3 SV=1 | 6 | 312 | 4.0E-50 |
| sp|B0CID9|HEM3_BRUSI | Porphobilinogen deaminase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=hemC PE=3 SV=1 | 6 | 312 | 4.0E-50 |
| sp|A9M8M2|HEM3_BRUC2 | Porphobilinogen deaminase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=hemC PE=3 SV=1 | 6 | 312 | 4.0E-50 |
| sp|Q2T071|HEM3_BURTA | Porphobilinogen deaminase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=hemC PE=3 SV=1 | 12 | 268 | 4.0E-50 |
| sp|B4E8C4|HEM3_BURCJ | Porphobilinogen deaminase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=hemC PE=3 SV=1 | 12 | 334 | 1.0E-49 |
| sp|Q8P536|HEM3_XANCP | Porphobilinogen deaminase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=hemC PE=3 SV=1 | 10 | 323 | 2.0E-49 |
| sp|Q4UYZ4|HEM3_XANC8 | Porphobilinogen deaminase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=hemC PE=3 SV=1 | 10 | 323 | 2.0E-49 |
| sp|Q9ZD77|HEM3_RICPR | Porphobilinogen deaminase OS=Rickettsia prowazekii (strain Madrid E) GN=hemC PE=3 SV=1 | 14 | 270 | 2.0E-49 |
| sp|B8D8B0|HEM3_BUCAT | Porphobilinogen deaminase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=hemC PE=3 SV=1 | 9 | 331 | 2.0E-49 |
| sp|P57651|HEM3_BUCAI | Porphobilinogen deaminase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=hemC PE=3 SV=1 | 9 | 331 | 2.0E-49 |
| sp|B8D8F3|HEM3_BUCA5 | Porphobilinogen deaminase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=hemC PE=3 SV=1 | 9 | 331 | 2.0E-49 |
| sp|B1JWR0|HEM3_BURCC | Porphobilinogen deaminase OS=Burkholderia cenocepacia (strain MC0-3) GN=hemC PE=3 SV=1 | 12 | 334 | 2.0E-49 |
| sp|B4RC21|HEM3_PHEZH | Porphobilinogen deaminase OS=Phenylobacterium zucineum (strain HLK1) GN=hemC PE=3 SV=1 | 11 | 307 | 5.0E-49 |
| sp|Q63W73|HEM3_BURPS | Porphobilinogen deaminase OS=Burkholderia pseudomallei (strain K96243) GN=hemC PE=3 SV=1 | 12 | 329 | 5.0E-49 |
| sp|Q3JUW3|HEM3_BURP1 | Porphobilinogen deaminase OS=Burkholderia pseudomallei (strain 1710b) GN=hemC PE=3 SV=1 | 12 | 329 | 5.0E-49 |
| sp|A3NSN6|HEM3_BURP0 | Porphobilinogen deaminase OS=Burkholderia pseudomallei (strain 1106a) GN=hemC PE=3 SV=1 | 12 | 329 | 5.0E-49 |
| sp|A1V5U0|HEM3_BURMS | Porphobilinogen deaminase OS=Burkholderia mallei (strain SAVP1) GN=hemC PE=3 SV=1 | 12 | 329 | 5.0E-49 |
| sp|Q62LC0|HEM3_BURMA | Porphobilinogen deaminase OS=Burkholderia mallei (strain ATCC 23344) GN=hemC PE=3 SV=1 | 12 | 329 | 5.0E-49 |
| sp|A2SAH5|HEM3_BURM9 | Porphobilinogen deaminase OS=Burkholderia mallei (strain NCTC 10229) GN=hemC PE=3 SV=1 | 12 | 329 | 5.0E-49 |
| sp|A3MLK5|HEM3_BURM7 | Porphobilinogen deaminase OS=Burkholderia mallei (strain NCTC 10247) GN=hemC PE=3 SV=1 | 12 | 329 | 5.0E-49 |
| sp|Q2LQU2|HEM3_SYNAS | Porphobilinogen deaminase OS=Syntrophus aciditrophicus (strain SB) GN=hemC PE=3 SV=1 | 12 | 262 | 7.0E-49 |
| sp|A6WXJ2|HEM3_OCHA4 | Porphobilinogen deaminase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=hemC PE=3 SV=1 | 6 | 324 | 7.0E-49 |
| sp|Q5GVL2|HEM3_XANOR | Porphobilinogen deaminase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=hemC PE=3 SV=1 | 10 | 326 | 8.0E-49 |
| sp|Q7M8L2|HEM3_WOLSU | Porphobilinogen deaminase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=hemC PE=3 SV=1 | 12 | 323 | 8.0E-49 |
| sp|A7ZD37|HEM3_CAMC1 | Porphobilinogen deaminase OS=Campylobacter concisus (strain 13826) GN=hemC PE=3 SV=1 | 12 | 324 | 8.0E-49 |
| sp|Q1RJN7|HEM3_RICBR | Porphobilinogen deaminase OS=Rickettsia bellii (strain RML369-C) GN=hemC PE=3 SV=1 | 14 | 311 | 9.0E-49 |
| sp|A8GXC8|HEM3_RICB8 | Porphobilinogen deaminase OS=Rickettsia bellii (strain OSU 85-389) GN=hemC PE=3 SV=1 | 14 | 311 | 9.0E-49 |
| sp|A3N700|HEM3_BURP6 | Porphobilinogen deaminase OS=Burkholderia pseudomallei (strain 668) GN=hemC PE=3 SV=1 | 12 | 329 | 1.0E-48 |
| sp|Q8PPR3|HEM3_XANAC | Porphobilinogen deaminase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=hemC PE=3 SV=1 | 10 | 323 | 1.0E-48 |
| sp|A4JGV4|HEM3_BURVG | Porphobilinogen deaminase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=hemC PE=3 SV=1 | 12 | 328 | 3.0E-48 |
| sp|Q3YSA8|HEM3_EHRCJ | Porphobilinogen deaminase OS=Ehrlichia canis (strain Jake) GN=hemC PE=3 SV=1 | 14 | 314 | 5.0E-48 |
| sp|Q0BCU9|HEM3_BURCM | Porphobilinogen deaminase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=hemC PE=3 SV=1 | 12 | 329 | 6.0E-48 |
| sp|Q4ULA5|HEM3_RICFE | Porphobilinogen deaminase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=hemC PE=3 SV=1 | 14 | 270 | 2.0E-47 |
| sp|Q59293|HEM3_CLOJO | Porphobilinogen deaminase OS=Clostridium josui GN=hemC PE=3 SV=2 | 12 | 262 | 2.0E-47 |
| sp|B8I0Q8|HEM3_CLOCE | Porphobilinogen deaminase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=hemC PE=3 SV=1 | 12 | 274 | 2.0E-47 |
| sp|Q92LH7|HEM3_RHIME | Porphobilinogen deaminase OS=Rhizobium meliloti (strain 1021) GN=hemC PE=3 SV=1 | 14 | 317 | 6.0E-47 |
| sp|Q87CC9|HEM3_XYLFT | Porphobilinogen deaminase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=hemC PE=3 SV=1 | 11 | 325 | 1.0E-46 |
| sp|B2I5K8|HEM3_XYLF2 | Porphobilinogen deaminase OS=Xylella fastidiosa (strain M23) GN=hemC PE=3 SV=1 | 11 | 325 | 1.0E-46 |
| sp|C4K265|HEM3_RICPU | Porphobilinogen deaminase OS=Rickettsia peacockii (strain Rustic) GN=hemC PE=3 SV=1 | 14 | 270 | 1.0E-46 |
| sp|C3PNS9|HEM3_RICAE | Porphobilinogen deaminase OS=Rickettsia africae (strain ESF-5) GN=hemC PE=3 SV=1 | 14 | 270 | 1.0E-46 |
| sp|Q92HR5|HEM3_RICCN | Porphobilinogen deaminase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=hemC PE=3 SV=1 | 14 | 270 | 1.0E-46 |
| sp|A8GSI6|HEM3_RICRS | Porphobilinogen deaminase OS=Rickettsia rickettsii (strain Sheila Smith) GN=hemC PE=3 SV=1 | 14 | 270 | 1.0E-46 |
| sp|B0BY00|HEM3_RICRO | Porphobilinogen deaminase OS=Rickettsia rickettsii (strain Iowa) GN=hemC PE=3 SV=1 | 14 | 270 | 1.0E-46 |
| sp|Q9PCX7|HEM3_XYLFA | Porphobilinogen deaminase OS=Xylella fastidiosa (strain 9a5c) GN=hemC PE=3 SV=1 | 11 | 325 | 2.0E-46 |
| sp|A8F1Y8|HEM3_RICM5 | Porphobilinogen deaminase OS=Rickettsia massiliae (strain Mtu5) GN=hemC PE=3 SV=1 | 14 | 270 | 3.0E-46 |
| sp|A8EYJ9|HEM3_RICCK | Porphobilinogen deaminase OS=Rickettsia canadensis (strain McKiel) GN=hemC PE=3 SV=1 | 14 | 270 | 3.0E-46 |
| sp|B8DKW2|HEM3_DESVM | Porphobilinogen deaminase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=hemC PE=3 SV=1 | 12 | 327 | 4.0E-46 |
| sp|B2FI06|HEM3_STRMK | Porphobilinogen deaminase OS=Stenotrophomonas maltophilia (strain K279a) GN=hemC PE=3 SV=1 | 14 | 324 | 4.0E-46 |
| sp|Q6AB05|HEM3_PROAC | Porphobilinogen deaminase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=hemC PE=3 SV=2 | 12 | 322 | 5.0E-46 |
| sp|B0U2W8|HEM3_XYLFM | Porphobilinogen deaminase OS=Xylella fastidiosa (strain M12) GN=hemC PE=3 SV=1 | 11 | 325 | 8.0E-46 |
| sp|B4SJT8|HEM3_STRM5 | Porphobilinogen deaminase OS=Stenotrophomonas maltophilia (strain R551-3) GN=hemC PE=3 SV=1 | 14 | 324 | 1.0E-45 |
| sp|Q7VFE9|HEM3_HELHP | Porphobilinogen deaminase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=hemC PE=3 SV=1 | 1 | 324 | 2.0E-45 |
| sp|Q8UC46|HEM3_AGRFC | Porphobilinogen deaminase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=hemC PE=3 SV=1 | 14 | 324 | 3.0E-45 |
| sp|Q7VRM4|HEM3_BLOFL | Porphobilinogen deaminase OS=Blochmannia floridanus GN=hemC PE=3 SV=1 | 11 | 315 | 4.0E-45 |
| sp|A6Q7Y4|HEM3_SULNB | Porphobilinogen deaminase OS=Sulfurovum sp. (strain NBC37-1) GN=hemC PE=3 SV=1 | 12 | 324 | 4.0E-45 |
| sp|Q6AHF1|HEM3_LEIXX | Porphobilinogen deaminase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=hemC PE=3 SV=1 | 4 | 319 | 4.0E-45 |
| sp|C0R2M3|HEM3_WOLWR | Porphobilinogen deaminase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=hemC PE=3 SV=1 | 11 | 317 | 6.0E-45 |
| sp|Q491Z6|HEM3_BLOPB | Porphobilinogen deaminase OS=Blochmannia pennsylvanicus (strain BPEN) GN=hemC PE=3 SV=1 | 8 | 317 | 7.0E-45 |
| sp|Q9WX16|HEM31_STRCO | Porphobilinogen deaminase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hemC1 PE=3 SV=1 | 12 | 323 | 8.0E-45 |
| sp|Q9PHW9|HEM3_CAMJE | Porphobilinogen deaminase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=hemC PE=3 SV=1 | 12 | 324 | 1.0E-44 |
| sp|A8FKW8|HEM3_CAMJ8 | Porphobilinogen deaminase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=hemC PE=3 SV=1 | 12 | 324 | 2.0E-44 |
| sp|Q1MPL2|HEM3_LAWIP | Porphobilinogen deaminase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=hemC PE=3 SV=1 | 12 | 327 | 2.0E-44 |
| sp|Q5HVM1|HEM3_CAMJR | Porphobilinogen deaminase OS=Campylobacter jejuni (strain RM1221) GN=hemC PE=3 SV=1 | 12 | 324 | 3.0E-44 |
| sp|A1VYQ4|HEM3_CAMJJ | Porphobilinogen deaminase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=hemC PE=3 SV=1 | 12 | 324 | 3.0E-44 |
| sp|C6BYB7|HEM3_DESAD | Porphobilinogen deaminase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=hemC PE=3 SV=1 | 12 | 326 | 3.0E-44 |
| sp|Q0W5T2|HEM3_METAR | Probable porphobilinogen deaminase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hemC PE=3 SV=1 | 12 | 324 | 5.0E-44 |
| sp|Q2GGC7|HEM3_EHRCR | Porphobilinogen deaminase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=hemC PE=3 SV=1 | 14 | 270 | 6.0E-44 |
| sp|Q97MU4|HEM3_CLOAB | Porphobilinogen deaminase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hemC PE=3 SV=1 | 12 | 263 | 7.0E-44 |
| sp|B9KGA9|HEM3_CAMLR | Porphobilinogen deaminase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=hemC PE=3 SV=1 | 12 | 324 | 8.0E-44 |
| sp|Q11XT5|HEM3_CYTH3 | Porphobilinogen deaminase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=hemC PE=3 SV=1 | 8 | 332 | 1.0E-43 |
| sp|A8MGE4|HEM3_ALKOO | Porphobilinogen deaminase OS=Alkaliphilus oremlandii (strain OhILAs) GN=hemC PE=3 SV=1 | 12 | 262 | 1.0E-43 |
| sp|Q1AUK3|HEM3_RUBXD | Porphobilinogen deaminase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=hemC PE=3 SV=1 | 12 | 330 | 1.0E-43 |
| sp|A7H4J7|HEM3_CAMJD | Porphobilinogen deaminase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=hemC PE=3 SV=1 | 12 | 264 | 2.0E-43 |
| sp|B2UXC4|HEM3_CLOBA | Porphobilinogen deaminase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=hemC PE=3 SV=1 | 12 | 263 | 2.0E-43 |
| sp|A1B853|HEM3_PARDP | Porphobilinogen deaminase OS=Paracoccus denitrificans (strain Pd 1222) GN=hemC PE=3 SV=1 | 12 | 315 | 3.0E-43 |
| sp|Q0BX92|HEM3_HYPNA | Porphobilinogen deaminase OS=Hyphomonas neptunium (strain ATCC 15444) GN=hemC PE=3 SV=1 | 12 | 262 | 4.0E-43 |
| sp|A5CDH4|HEM3_ORITB | Porphobilinogen deaminase OS=Orientia tsutsugamushi (strain Boryong) GN=hemC PE=3 SV=1 | 11 | 269 | 5.0E-43 |
| sp|A9A1A1|HEM3_NITMS | Probable porphobilinogen deaminase OS=Nitrosopumilus maritimus (strain SCM1) GN=hemC PE=3 SV=1 | 14 | 324 | 8.0E-43 |
| sp|B2TPD7|HEM3_CLOBB | Porphobilinogen deaminase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=hemC PE=3 SV=1 | 12 | 263 | 1.0E-42 |
| sp|Q1GP41|HEM3_SPHAL | Porphobilinogen deaminase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=hemC PE=3 SV=1 | 9 | 309 | 1.0E-42 |
| sp|O29026|HEM3_ARCFU | Probable porphobilinogen deaminase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hemC PE=3 SV=1 | 12 | 264 | 2.0E-42 |
| sp|Q57989|HEM3_METJA | Probable porphobilinogen deaminase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hemC PE=3 SV=1 | 11 | 309 | 5.0E-42 |
| sp|Q8XKG4|HEM3_CLOPE | Porphobilinogen deaminase OS=Clostridium perfringens (strain 13 / Type A) GN=hemC PE=3 SV=1 | 12 | 263 | 5.0E-42 |
| sp|Q17W61|HEM3_HELAH | Porphobilinogen deaminase OS=Helicobacter acinonychis (strain Sheeba) GN=hemC PE=3 SV=1 | 12 | 327 | 5.0E-42 |
| sp|Q0TQG4|HEM3_CLOP1 | Porphobilinogen deaminase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=hemC PE=3 SV=1 | 12 | 263 | 6.0E-42 |
| sp|A1VCX6|HEM3_DESVV | Porphobilinogen deaminase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=hemC PE=3 SV=1 | 12 | 329 | 8.0E-42 |
| sp|A6LSY5|HEM3_CLOB8 | Porphobilinogen deaminase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=hemC PE=3 SV=1 | 12 | 263 | 1.0E-41 |
| sp|P56140|HEM3_HELPY | Porphobilinogen deaminase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=hemC PE=3 SV=1 | 12 | 324 | 2.0E-41 |
| sp|Q72AV0|HEM3_DESVH | Porphobilinogen deaminase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=hemC PE=3 SV=1 | 12 | 329 | 2.0E-41 |
| sp|B6JKG8|HEM3_HELP2 | Porphobilinogen deaminase OS=Helicobacter pylori (strain P12) GN=hemC PE=3 SV=1 | 12 | 324 | 2.0E-41 |
| sp|P9WMP3|HEM3_MYCTU | Porphobilinogen deaminase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hemC PE=1 SV=1 | 11 | 326 | 2.0E-41 |
| sp|P9WMP2|HEM3_MYCTO | Porphobilinogen deaminase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hemC PE=3 SV=1 | 11 | 326 | 2.0E-41 |
| sp|A5TZP0|HEM3_MYCTA | Porphobilinogen deaminase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=hemC PE=3 SV=1 | 11 | 326 | 2.0E-41 |
| sp|C1AKJ0|HEM3_MYCBT | Porphobilinogen deaminase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=hemC PE=3 SV=1 | 11 | 326 | 2.0E-41 |
| sp|A1KFY6|HEM3_MYCBP | Porphobilinogen deaminase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=hemC PE=3 SV=1 | 11 | 326 | 2.0E-41 |
| sp|P64337|HEM3_MYCBO | Porphobilinogen deaminase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=hemC PE=3 SV=1 | 11 | 326 | 2.0E-41 |
| sp|Q9KY00|HEM32_STRCO | Porphobilinogen deaminase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hemC2 PE=3 SV=1 | 11 | 285 | 3.0E-41 |
| sp|A0RNT3|HEM3_CAMFF | Porphobilinogen deaminase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=hemC PE=3 SV=1 | 12 | 324 | 5.0E-41 |
| sp|Q0ST16|HEM3_CLOPS | Porphobilinogen deaminase OS=Clostridium perfringens (strain SM101 / Type A) GN=hemC PE=3 SV=1 | 12 | 263 | 5.0E-41 |
| sp|Q9ZMJ7|HEM3_HELPJ | Porphobilinogen deaminase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=hemC PE=3 SV=1 | 12 | 324 | 6.0E-41 |
| sp|Q82P95|HEM32_STRAW | Porphobilinogen deaminase 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=hemC2 PE=3 SV=1 | 11 | 290 | 6.0E-41 |
| sp|B9DZL6|HEM3_CLOK1 | Porphobilinogen deaminase OS=Clostridium kluyveri (strain NBRC 12016) GN=hemC PE=3 SV=1 | 14 | 263 | 6.0E-41 |
| sp|Q5YP70|HEM3_NOCFA | Porphobilinogen deaminase OS=Nocardia farcinica (strain IFM 10152) GN=hemC PE=3 SV=1 | 6 | 335 | 7.0E-41 |
| sp|Q82E76|HEM31_STRAW | Porphobilinogen deaminase 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=hemC1 PE=3 SV=1 | 8 | 323 | 8.0E-41 |
| sp|B5ZA04|HEM3_HELPG | Porphobilinogen deaminase OS=Helicobacter pylori (strain G27) GN=hemC PE=3 SV=1 | 12 | 324 | 8.0E-41 |
| sp|Q49808|HEM3_MYCLE | Porphobilinogen deaminase OS=Mycobacterium leprae (strain TN) GN=hemC PE=3 SV=2 | 11 | 332 | 1.0E-40 |
| sp|A3DIF0|HEM3_CLOTH | Porphobilinogen deaminase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=hemC PE=3 SV=1 | 12 | 261 | 1.0E-40 |
| sp|A8ZWG5|HEM3_DESOH | Porphobilinogen deaminase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=hemC PE=3 SV=1 | 14 | 261 | 2.0E-40 |
| sp|A8AAB4|HEM3_IGNH4 | Probable porphobilinogen deaminase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=hemC PE=3 SV=1 | 12 | 314 | 6.0E-40 |
| sp|Q30Y29|HEM3_DESAG | Porphobilinogen deaminase OS=Desulfovibrio alaskensis (strain G20) GN=hemC PE=3 SV=1 | 12 | 262 | 6.0E-40 |
| sp|A0PW29|HEM3_MYCUA | Porphobilinogen deaminase OS=Mycobacterium ulcerans (strain Agy99) GN=hemC PE=3 SV=1 | 11 | 323 | 7.0E-40 |
| sp|B2HRJ2|HEM3_MYCMM | Porphobilinogen deaminase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=hemC PE=3 SV=1 | 11 | 323 | 2.0E-39 |
| sp|B3CUP9|HEM3_ORITI | Porphobilinogen deaminase OS=Orientia tsutsugamushi (strain Ikeda) GN=hemC PE=3 SV=1 | 11 | 269 | 4.0E-39 |
| sp|A4QB59|HEM3_CORGB | Porphobilinogen deaminase OS=Corynebacterium glutamicum (strain R) GN=hemC PE=3 SV=1 | 12 | 323 | 7.0E-39 |
| sp|A4T340|HEM3_MYCGI | Porphobilinogen deaminase OS=Mycobacterium gilvum (strain PYR-GCK) GN=hemC PE=3 SV=1 | 11 | 324 | 1.0E-38 |
| sp|Q73SS0|HEM3_MYCPA | Porphobilinogen deaminase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=hemC PE=3 SV=1 | 11 | 333 | 1.0E-38 |
| sp|Q9ABZ8|HEM3_CAUCR | Porphobilinogen deaminase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hemC PE=3 SV=1 | 12 | 263 | 1.0E-38 |
| sp|B8GXG1|HEM3_CAUCN | Porphobilinogen deaminase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=hemC PE=3 SV=1 | 12 | 263 | 1.0E-38 |
| sp|A0QLI0|HEM3_MYCA1 | Porphobilinogen deaminase OS=Mycobacterium avium (strain 104) GN=hemC PE=3 SV=1 | 11 | 333 | 4.0E-38 |
| sp|B2US69|HEM3_HELPS | Porphobilinogen deaminase OS=Helicobacter pylori (strain Shi470) GN=hemC PE=3 SV=1 | 12 | 324 | 4.0E-38 |
| sp|Q8NT90|HEM3_CORGL | Porphobilinogen deaminase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=hemC PE=3 SV=1 | 12 | 323 | 7.0E-38 |
| sp|P30527|HEM3_YERIN | Porphobilinogen deaminase (Fragment) OS=Yersinia intermedia GN=hemC PE=3 SV=1 | 9 | 197 | 8.0E-38 |
| sp|A8MDU3|HEM3_CALMQ | Probable porphobilinogen deaminase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=hemC PE=3 SV=1 | 11 | 315 | 1.0E-37 |
| sp|Q1CUR5|HEM3_HELPH | Porphobilinogen deaminase OS=Helicobacter pylori (strain HPAG1) GN=hemC PE=3 SV=1 | 12 | 324 | 2.0E-37 |
| sp|O26960|HEM3_METTH | Probable porphobilinogen deaminase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hemC PE=3 SV=1 | 12 | 314 | 2.0E-37 |
| sp|Q8FSF7|HEM3_COREF | Porphobilinogen deaminase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=hemC PE=3 SV=1 | 12 | 323 | 2.0E-37 |
| sp|A2BL26|HEM3_HYPBU | Probable porphobilinogen deaminase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=hemC PE=3 SV=1 | 12 | 316 | 3.0E-37 |
| sp|Q12WM8|HEM3_METBU | Probable porphobilinogen deaminase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hemC PE=3 SV=1 | 12 | 292 | 3.0E-37 |
| sp|B0T287|HEM3_CAUSK | Porphobilinogen deaminase OS=Caulobacter sp. (strain K31) GN=hemC PE=3 SV=1 | 12 | 263 | 4.0E-37 |
| sp|C3PKG2|HEM3_CORA7 | Porphobilinogen deaminase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=hemC PE=3 SV=1 | 11 | 325 | 6.0E-37 |
| sp|Q7UPN0|HEM3_RHOBA | Porphobilinogen deaminase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hemC PE=3 SV=1 | 4 | 326 | 9.0E-37 |
| sp|C5CB88|HEM3_MICLC | Porphobilinogen deaminase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=hemC PE=3 SV=1 | 12 | 263 | 1.0E-36 |
| sp|A1T3D3|HEM3_MYCVP | Porphobilinogen deaminase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=hemC PE=3 SV=1 | 11 | 324 | 2.0E-36 |
| sp|Q6NJK0|HEM3_CORDI | Porphobilinogen deaminase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=hemC PE=3 SV=1 | 12 | 323 | 3.0E-36 |
| sp|B1IHD1|HEM3_CLOBK | Porphobilinogen deaminase OS=Clostridium botulinum (strain Okra / Type B1) GN=hemC PE=3 SV=1 | 12 | 267 | 3.0E-36 |
| sp|B1KY15|HEM3_CLOBM | Porphobilinogen deaminase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=hemC PE=3 SV=1 | 12 | 267 | 3.0E-36 |
| sp|C1FVB9|HEM3_CLOBJ | Porphobilinogen deaminase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=hemC PE=3 SV=1 | 12 | 267 | 3.0E-36 |
| sp|A7GBW3|HEM3_CLOBL | Porphobilinogen deaminase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=hemC PE=3 SV=1 | 12 | 267 | 4.0E-36 |
| sp|A5I0B2|HEM3_CLOBH | Porphobilinogen deaminase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=hemC PE=3 SV=1 | 12 | 267 | 5.0E-36 |
| sp|A7FSG8|HEM3_CLOB1 | Porphobilinogen deaminase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=hemC PE=3 SV=1 | 12 | 267 | 5.0E-36 |
| sp|A1RQK2|HEM3_PYRIL | Probable porphobilinogen deaminase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=hemC PE=3 SV=1 | 12 | 312 | 7.0E-36 |
| sp|Q8TT56|HEM3_METAC | Probable porphobilinogen deaminase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hemC PE=3 SV=1 | 12 | 324 | 1.0E-35 |
| sp|C3L2Z3|HEM3_CLOB6 | Porphobilinogen deaminase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=hemC PE=3 SV=1 | 12 | 267 | 7.0E-35 |
| sp|Q6L2G8|HEM3_PICTO | Probable porphobilinogen deaminase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=hemC PE=3 SV=1 | 14 | 264 | 1.0E-34 |
| sp|A4XK06|HEM3_CALS8 | Porphobilinogen deaminase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=hemC PE=3 SV=1 | 12 | 264 | 2.0E-34 |
| sp|B1MHI5|HEM3_MYCA9 | Porphobilinogen deaminase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=hemC PE=3 SV=1 | 11 | 270 | 3.0E-34 |
| sp|Q8ZYW7|HEM3_PYRAE | Probable porphobilinogen deaminase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=hemC PE=3 SV=1 | 12 | 314 | 3.0E-34 |
| sp|A4WN24|HEM3_PYRAR | Probable porphobilinogen deaminase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=hemC PE=3 SV=1 | 12 | 263 | 4.0E-33 |
| sp|Q8TXC8|HEM3_METKA | Probable porphobilinogen deaminase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=hemC PE=3 SV=2 | 12 | 264 | 7.0E-33 |
| sp|Q97B26|HEM3_THEVO | Probable porphobilinogen deaminase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hemC PE=3 SV=1 | 12 | 264 | 1.0E-32 |
| sp|Q46CH0|HEM3_METBF | Probable porphobilinogen deaminase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hemC PE=3 SV=1 | 12 | 312 | 3.0E-32 |
| sp|Q8PW57|HEM3_METMA | Probable porphobilinogen deaminase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hemC PE=3 SV=1 | 12 | 324 | 3.0E-32 |
| sp|B1YDP0|HEM3_PYRNV | Probable porphobilinogen deaminase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=hemC PE=3 SV=1 | 12 | 263 | 5.0E-30 |
| sp|A3MWV7|HEM3_PYRCJ | Probable porphobilinogen deaminase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=hemC PE=3 SV=1 | 12 | 314 | 4.0E-29 |
| sp|A4YD92|HEM3_METS5 | Probable porphobilinogen deaminase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=hemC PE=3 SV=1 | 12 | 308 | 1.0E-28 |
| sp|Q9HKM5|HEM3_THEAC | Probable porphobilinogen deaminase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hemC PE=3 SV=1 | 12 | 287 | 1.0E-27 |
| sp|Q976H1|HEM3_SULTO | Probable porphobilinogen deaminase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hemC PE=3 SV=1 | 12 | 318 | 8.0E-25 |
| sp|Q980U4|HEM3_SULSO | Probable porphobilinogen deaminase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hemC PE=3 SV=1 | 12 | 264 | 1.0E-22 |
| sp|C3MYD9|HEM3_SULIM | Probable porphobilinogen deaminase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=hemC PE=3 SV=1 | 12 | 264 | 4.0E-22 |
| sp|C3MZR8|HEM3_SULIA | Probable porphobilinogen deaminase OS=Sulfolobus islandicus (strain M.16.27) GN=hemC PE=3 SV=1 | 12 | 264 | 4.0E-22 |
| sp|C3MJ21|HEM3_SULIL | Probable porphobilinogen deaminase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=hemC PE=3 SV=1 | 12 | 264 | 4.0E-22 |
| sp|C4KIZ9|HEM3_SULIK | Probable porphobilinogen deaminase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=hemC PE=3 SV=1 | 12 | 264 | 4.0E-22 |
| sp|C3N841|HEM3_SULIY | Probable porphobilinogen deaminase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=hemC PE=3 SV=1 | 12 | 264 | 5.0E-22 |
| sp|C3NF70|HEM3_SULIN | Probable porphobilinogen deaminase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=hemC PE=3 SV=1 | 12 | 264 | 5.0E-22 |
| sp|Q9Y9J0|HEM3_AERPE | Probable porphobilinogen deaminase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=hemC PE=3 SV=2 | 12 | 288 | 1.0E-21 |
| sp|Q9PK95|HEM3_CHLMU | Probable porphobilinogen deaminase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=hemC PE=3 SV=1 | 12 | 193 | 5.0E-21 |
| sp|Q9HMY5|HEM3_HALSA | Probable porphobilinogen deaminase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hemC PE=3 SV=1 | 12 | 172 | 1.0E-20 |
| sp|O84301|HEM3_CHLTR | Probable porphobilinogen deaminase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=hemC PE=3 SV=1 | 12 | 193 | 2.0E-19 |
| sp|Q9Z9C9|HEM3_CHLPN | Probable porphobilinogen deaminase OS=Chlamydia pneumoniae GN=hemC PE=3 SV=1 | 12 | 219 | 5.0E-14 |
| sp|P40129|HEM3_DICCH | Porphobilinogen deaminase (Fragment) OS=Dickeya chrysanthemi GN=hemC PE=3 SV=1 | 9 | 95 | 1.0E-11 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0004418 | hydroxymethylbilane synthase activity | Yes |
| GO:0033014 | tetrapyrrole biosynthetic process | Yes |
| GO:0016740 | transferase activity | No |
| GO:1901360 | organic cyclic compound metabolic process | No |
| GO:0008150 | biological_process | No |
| GO:0006725 | cellular aromatic compound metabolic process | No |
| GO:0018130 | heterocycle biosynthetic process | No |
| GO:1901564 | organonitrogen compound metabolic process | No |
| GO:1901566 | organonitrogen compound biosynthetic process | No |
| GO:0046483 | heterocycle metabolic process | No |
| GO:1901576 | organic substance biosynthetic process | No |
| GO:0008152 | metabolic process | No |
| GO:0044237 | cellular metabolic process | No |
| GO:0003674 | molecular_function | No |
| GO:0019438 | aromatic compound biosynthetic process | No |
| GO:0033013 | tetrapyrrole metabolic process | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:0009987 | cellular process | No |
| GO:0044271 | cellular nitrogen compound biosynthetic process | No |
| GO:1901362 | organic cyclic compound biosynthetic process | No |
| GO:0016765 | transferase activity, transferring alkyl or aryl (other than methyl) groups | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| GO:0003824 | catalytic activity | No |
| GO:0034641 | cellular nitrogen compound metabolic process | No |
| GO:0044249 | cellular biosynthetic process | No |
| GO:0009058 | biosynthetic process | No |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Mitochondrion | 0.4373 | 0.2934 | 0.0052 | 0.1222 | 0.5999 | 0.347 | 0.4334 | 0.3453 | 0.18 | 0.264 |
| Orthofinder run ID | 4 |
| Orthogroup | 3252 |
| Change Orthofinder run |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Ophio5|1760 MAEPTSANDTIMTVGTRQSPLALAQTDIVVSALKALFPTFSFPVHSMTTTGDRDQHTALYDFGGKGLWTSQLEEK LVARELDMVVHSLKDMPTSLPAGCALGCITHREDPRDTLVIKASLARDKGWKTLADLPNGAVIGTSSVRRIAQLA RRYPGLRFKDVRGNIQTRLRKLDDDPDMAALVLAAAGLQRMGLSDRISQYLDKDGGGILHAVGQGALAVECRAGD ERVLGALRRLADEPTTLACLAERSLMRTLEGGCSVPIGVETSWVEPGLLRFRAAVVSAPGTDAVDIELTEDVSSA AAAEELGKRAAHDLVSRGADKILEAVNAARTKPGASAAVAQAPVAAEQG |
| Coding | >Ophio5|1760 ATGGCCGAGCCGACGTCGGCAAACGACACCATCATGACCGTTGGCACGCGCCAGTCGCCGCTCGCCCTCGCCCAG ACAGACATCGTCGTCTCCGCCCTCAAAGCCCTCTTCCCGACCTTCTCCTTTCCCGTCCACAGCATGACGACAACA GGCGACCGCGACCAGCACACGGCCCTCTACGACTTCGGTGGCAAAGGCCTGTGGACCTCGCAGCTCGAGGAGAAG CTCGTCGCCCGTGAGCTCGACATGGTCGTCCACTCGCTCAAGGACATGCCCACCTCTTTGCCCGCCGGCTGCGCT CTTGGCTGCATCACCCATCGGGAGGACCCCCGTGACACCCTCGTCATCAAAGCCAGCCTCGCCCGGGACAAGGGC TGGAAGACACTGGCCGACCTGCCCAACGGCGCCGTAATTGGCACAAGCAGCGTGCGGCGTATCGCCCAGCTCGCC CGCCGCTATCCCGGTCTCCGGTTCAAGGATGTGCGCGGCAATATACAGACGCGCTTGCGCAAGCTCGACGACGAC CCGGACATGGCCGCCCTCGTCCTCGCCGCCGCCGGCCTGCAGCGTATGGGCCTGAGCGACCGCATCTCGCAGTAC CTCGACAAGGATGGCGGCGGCATTCTACACGCCGTCGGCCAGGGCGCCCTCGCCGTCGAGTGCCGTGCCGGAGAC GAGCGTGTTCTCGGGGCCCTGCGTCGCCTGGCCGACGAGCCCACCACGCTCGCCTGCCTGGCGGAGAGAAGCTTG ATGCGCACGCTGGAAGGCGGCTGCAGCGTGCCCATTGGCGTTGAGACCAGCTGGGTTGAGCCTGGCCTGCTGCGC TTCCGTGCCGCCGTCGTCTCGGCCCCAGGCACCGATGCCGTCGACATCGAGTTGACCGAAGACGTCAGCAGCGCC GCCGCGGCCGAAGAGCTGGGGAAGCGCGCGGCTCACGATCTCGTCAGTCGGGGAGCTGACAAGATCCTGGAGGCG GTCAACGCGGCGCGGACGAAGCCGGGAGCTTCAGCCGCTGTTGCCCAAGCTCCTGTCGCTGCCGAACAGGGC |
| Transcript | >Ophio5|1760 ATGGCCGAGCCGACGTCGGCAAACGACACCATCATGACCGTTGGCACGCGCCAGTCGCCGCTCGCCCTCGCCCAG ACAGACATCGTCGTCTCCGCCCTCAAAGCCCTCTTCCCGACCTTCTCCTTTCCCGTCCACAGCATGACGACAACA GGCGACCGCGACCAGCACACGGCCCTCTACGACTTCGGTGGCAAAGGCCTGTGGACCTCGCAGCTCGAGGAGAAG CTCGTCGCCCGTGAGCTCGACATGGTCGTCCACTCGCTCAAGGACATGCCCACCTCTTTGCCCGCCGGCTGCGCT CTTGGCTGCATCACCCATCGGGAGGACCCCCGTGACACCCTCGTCATCAAAGCCAGCCTCGCCCGGGACAAGGGC TGGAAGACACTGGCCGACCTGCCCAACGGCGCCGTAATTGGCACAAGCAGCGTGCGGCGTATCGCCCAGCTCGCC CGCCGCTATCCCGGTCTCCGGTTCAAGGATGTGCGCGGCAATATACAGACGCGCTTGCGCAAGCTCGACGACGAC CCGGACATGGCCGCCCTCGTCCTCGCCGCCGCCGGCCTGCAGCGTATGGGCCTGAGCGACCGCATCTCGCAGTAC CTCGACAAGGATGGCGGCGGCATTCTACACGCCGTCGGCCAGGGCGCCCTCGCCGTCGAGTGCCGTGCCGGAGAC GAGCGTGTTCTCGGGGCCCTGCGTCGCCTGGCCGACGAGCCCACCACGCTCGCCTGCCTGGCGGAGAGAAGCTTG ATGCGCACGCTGGAAGGCGGCTGCAGCGTGCCCATTGGCGTTGAGACCAGCTGGGTTGAGCCTGGCCTGCTGCGC TTCCGTGCCGCCGTCGTCTCGGCCCCAGGCACCGATGCCGTCGACATCGAGTTGACCGAAGACGTCAGCAGCGCC GCCGCGGCCGAAGAGCTGGGGAAGCGCGCGGCTCACGATCTCGTCAGTCGGGGAGCTGACAAGATCCTGGAGGCG GTCAACGCGGCGCGGACGAAGCCGGGAGCTTCAGCCGCTGTTGCCCAAGCTCCTGTCGCTGCCGAACAGGGCTGA |
| Gene | >Ophio5|1760 ATGGCCGAGCCGACGTCGGCAAACGACACCATCATGACCGTTGGCACGCGCCAGTCGCCGCTCGCCCTCGCCCAG ACAGACATCGTCGTCTCCGCCCTCAAAGCCCTCTTCCCGACCTTCTCCTTTCCCGTCCACAGCATGACGACAACA GGCGACCGCGACCAGCACACGGCCCTCTACGACTTCGGTGGCAAAGGCCTGTGGACCTCGCAGCTCGAGGAGAAG CTCGTCGCCCGTGAGCTCGACATGGTCGTCCACTCGCTCAAGGACATGCCCACCTCTTTGCCCGCCGGCTGCGCT CTTGGCTGCATCACCCATCGGGAGGACCCCCGTGACACCCTCGTCATCAAAGCCAGCCTCGCCCGGGACAAGGGC TGGAAGACACTGGCCGACCTGCCCAACGGCGCCGTAATTGGCACAAGCAGCGTGCGGCGTATCGCCCAGCTCGCC CGCCGCTATCCCGGTCTCCGGTTCAAGGATGTGCGCGGCAATATACAGACGCGCTTGCGCAAGCTCGACGACGAC CCGGACATGGCCGCCCTCGTCCTCGCCGCCGCCGGCCTGCAGCGTATGGGCCTGAGCGACCGCATCTCGCAGTAC CTCGACAAGGATGGCGGCGGCATTCTACACGCCGTCGGCCAGGGCGCCCTCGCCGTCGAGTGCCGTGCCGGAGAC GAGCGTGTTCTCGGGGCCCTGCGTCGCCTGGCCGACGAGCCCACCACGCTCGCCTGCCTGGCGGAGAGAAGCTTG ATGCGCACGCTGGAAGGCGGCTGCAGCGTGCCCATTGGCGTTGAGACCAGCTGGGTTGAGCCTGGCCTGCTGCGC TTCCGTGCCGCCGTCGTCTCGGCCCCAGGCACCGATGCCGTCGACATCGAGTTGACCGAAGACGTCAGCAGCGCC GCCGCGGCCGAAGAGCTGGGGAAGCGCGCGGCTCACGATCTCGTCAGTCGGGGAGCTGACAAGATCCTGGAGGCG GTCAACGCGGCGCGGACGAAGCCGGGAGCTTCAGCCGCTGTTGCCCAAGCTCCTGTCGCTGCCGAACAGGGCTGA |