Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1758
Gene name
Locationscaffold_166:25152..28871
Strand-
Gene length (bp)3719
Transcript length (bp)3273
Coding sequence length (bp)3270
Protein length (aa) 1090

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02233 PNTB NAD(P) transhydrogenase beta subunit 1.9E-164 632 1083
PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain 6.0E-71 226 450
PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain 3.0E-47 86 222
PF12769 PNTB_4TM 4TM region of pyridine nucleotide transhydrogenase, mitoch 3.7E-29 513 597

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P11024|NNTM_BOVIN NAD(P) transhydrogenase, mitochondrial OS=Bos taurus GN=NNT PE=1 SV=3 69 1090 0.0E+00
sp|Q13423|NNTM_HUMAN NAD(P) transhydrogenase, mitochondrial OS=Homo sapiens GN=NNT PE=1 SV=3 67 1090 0.0E+00
sp|Q61941|NNTM_MOUSE NAD(P) transhydrogenase, mitochondrial OS=Mus musculus GN=Nnt PE=1 SV=2 74 1090 0.0E+00
sp|P07001|PNTA_ECOLI NAD(P) transhydrogenase subunit alpha OS=Escherichia coli (strain K12) GN=pntA PE=1 SV=2 83 597 1.0E-155
sp|Q9ALA2|PNTA_RHOSH NAD(P) transhydrogenase subunit alpha OS=Rhodobacter sphaeroides GN=pntA PE=1 SV=1 83 597 3.0E-155
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P11024|NNTM_BOVIN NAD(P) transhydrogenase, mitochondrial OS=Bos taurus GN=NNT PE=1 SV=3 69 1090 0.0E+00
sp|Q13423|NNTM_HUMAN NAD(P) transhydrogenase, mitochondrial OS=Homo sapiens GN=NNT PE=1 SV=3 67 1090 0.0E+00
sp|Q61941|NNTM_MOUSE NAD(P) transhydrogenase, mitochondrial OS=Mus musculus GN=Nnt PE=1 SV=2 74 1090 0.0E+00
sp|P07001|PNTA_ECOLI NAD(P) transhydrogenase subunit alpha OS=Escherichia coli (strain K12) GN=pntA PE=1 SV=2 83 597 1.0E-155
sp|Q9ALA2|PNTA_RHOSH NAD(P) transhydrogenase subunit alpha OS=Rhodobacter sphaeroides GN=pntA PE=1 SV=1 83 597 3.0E-155
sp|P43842|PNTA_HAEIN NAD(P) transhydrogenase subunit alpha OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pntA PE=3 SV=1 83 597 2.0E-150
sp|P0AB70|PNTB_SHIFL NAD(P) transhydrogenase subunit beta OS=Shigella flexneri GN=pntB PE=3 SV=1 627 1085 2.0E-130
sp|P0AB67|PNTB_ECOLI NAD(P) transhydrogenase subunit beta OS=Escherichia coli (strain K12) GN=pntB PE=1 SV=1 627 1085 2.0E-130
sp|P0AB68|PNTB_ECOL6 NAD(P) transhydrogenase subunit beta OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pntB PE=3 SV=1 627 1085 2.0E-130
sp|P0AB69|PNTB_ECO57 NAD(P) transhydrogenase subunit beta OS=Escherichia coli O157:H7 GN=pntB PE=3 SV=1 627 1085 2.0E-130
sp|P43010|PNTB_HAEIN NAD(P) transhydrogenase subunit beta OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pntB PE=3 SV=1 629 1085 3.0E-128
sp|P0C188|PNTB_RHORU NAD(P) transhydrogenase subunit beta OS=Rhodospirillum rubrum GN=pntB PE=1 SV=1 630 1086 7.0E-99
sp|Q2RSB4|PNTB_RHORT NAD(P) transhydrogenase subunit beta OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pntB PE=1 SV=1 630 1086 7.0E-99
sp|P0C186|PNTAA_RHORU NAD(P) transhydrogenase subunit alpha part 1 OS=Rhodospirillum rubrum GN=pntAA PE=3 SV=1 83 453 7.0E-93
sp|Q2RSB2|PNTAA_RHORT NAD(P) transhydrogenase subunit alpha part 1 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pntAA PE=1 SV=1 83 453 7.0E-93
sp|P41077|PNTAA_RICPR NAD(P) transhydrogenase subunit alpha part 1 OS=Rickettsia prowazekii (strain Madrid E) GN=pntAA PE=3 SV=2 90 450 3.0E-81
sp|Q8KY18|DHA_MYCSM Alanine dehydrogenase OS=Mycobacterium smegmatis GN=ald PE=1 SV=1 85 453 6.0E-31
sp|A0QVQ8|DHA_MYCS2 Alanine dehydrogenase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ald PE=1 SV=1 85 453 6.0E-31
sp|P17556|DHA_LYSSH Alanine dehydrogenase OS=Lysinibacillus sphaericus GN=ald PE=1 SV=1 83 449 5.0E-30
sp|Q2YTD1|DHA2_STAAB Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ald2 PE=3 SV=1 83 416 1.0E-29
sp|Q2FG29|DHA2_STAA3 Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain USA300) GN=ald2 PE=3 SV=1 83 416 2.0E-29
sp|Q2FXL7|DHA2_STAA8 Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain NCTC 8325) GN=ald2 PE=3 SV=1 83 416 2.0E-29
sp|Q5HF65|DHA2_STAAC Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain COL) GN=ald2 PE=3 SV=1 83 416 2.0E-29
sp|Q6G8L8|DHA2_STAAS Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain MSSA476) GN=ald2 PE=3 SV=1 83 416 2.0E-29
sp|Q99TF4|DHA2_STAAN Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain N315) GN=ald2 PE=1 SV=1 83 416 2.0E-29
sp|Q6GFZ8|DHA2_STAAR Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain MRSA252) GN=ald2 PE=3 SV=1 83 416 2.0E-29
sp|P9WQB1|DHA_MYCTU Alanine dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ald PE=1 SV=1 83 425 2.0E-29
sp|Q931P7|DHA2_STAAM Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ald2 PE=3 SV=1 83 416 2.0E-29
sp|Q8NW54|DHA2_STAAW Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain MW2) GN=ald2 PE=3 SV=1 83 416 2.0E-29
sp|P9WQB0|DHA_MYCTO Alanine dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ald PE=3 SV=1 83 423 3.0E-29
sp|Q08352|DHA_BACSU Alanine dehydrogenase OS=Bacillus subtilis (strain 168) GN=ald PE=1 SV=1 83 416 2.0E-28
sp|Q8CNW8|DHA_STAES Alanine dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ald PE=3 SV=1 83 416 2.0E-28
sp|Q5HNJ6|DHA_STAEQ Alanine dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ald PE=3 SV=1 83 416 2.0E-28
sp|Q4L750|DHA_STAHJ Alanine dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ald PE=3 SV=1 83 416 5.0E-28
sp|Q49YD9|DHA_STAS1 Alanine dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ald PE=3 SV=1 83 416 1.0E-27
sp|Q8CX61|DHA_OCEIH Alanine dehydrogenase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ald PE=3 SV=1 83 416 5.0E-27
sp|P17557|DHA_GEOSE Alanine dehydrogenase OS=Geobacillus stearothermophilus GN=ald PE=1 SV=1 83 453 7.0E-24
sp|Q6GGW9|DHA1_STAAR Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain MRSA252) GN=ald1 PE=3 SV=1 83 419 9.0E-24
sp|P99151|DHA1_STAAN Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain N315) GN=ald1 PE=1 SV=1 83 419 1.0E-23
sp|P63478|DHA1_STAAM Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ald1 PE=3 SV=1 83 419 1.0E-23
sp|Q5HFY4|DHA1_STAAC Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain COL) GN=ald1 PE=3 SV=1 83 419 1.0E-23
sp|Q2FH00|DHA1_STAA3 Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain USA300) GN=ald1 PE=3 SV=1 83 419 1.0E-23
sp|Q8NWQ3|DHA1_STAAW Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain MW2) GN=ald1 PE=3 SV=1 83 419 1.0E-23
sp|Q6G9C3|DHA1_STAAS Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain MSSA476) GN=ald1 PE=3 SV=1 83 419 1.0E-23
sp|Q2FYJ2|DHA1_STAA8 Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=ald1 PE=3 SV=1 83 419 9.0E-23
sp|Q2YY66|DHA1_STAAB Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ald1 PE=3 SV=1 83 419 2.0E-21
sp|Q6LX40|DHA_METMP Alanine dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=ald PE=1 SV=1 85 449 1.0E-20
sp|P51995|PNTAB_RICPR NAD(P) transhydrogenase subunit alpha part 2 OS=Rickettsia prowazekii (strain Madrid E) GN=pntAB PE=3 SV=2 460 597 3.0E-19
sp|P0C187|PNTAB_RHORU NAD(P) transhydrogenase subunit alpha part 2 OS=Rhodospirillum rubrum GN=pntAB PE=3 SV=1 515 600 1.0E-17
sp|Q2RSB3|PNTAB_RHORT NAD(P) transhydrogenase subunit alpha part 2 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pntAB PE=3 SV=1 515 600 1.0E-17
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 505 527 22
2 539 561 22
3 565 587 22
4 604 623 19
5 628 650 22
6 657 679 22
7 683 702 19
8 714 735 21
9 745 767 22
10 780 802 22
11 806 825 19
12 832 854 22
13 864 886 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1758
MVSSNVLVSGLRPASARLALRAASVILSRRWLSSPHRRSLVAAAPKALALLRYAPSPYYLPSLAPAEPYSTIAVP
PTRPYARLAVGVPAEVFPGERRVALTPANVALLLNKGFDRLIVQRGAGAAAGFLDEAYEKAGATLVDGAGAVWSD
AQVVLKVRSPSAQEVDAIKESQVVISFLQPAQNHDLVRRIAERRATCFAMDMVPRISRAQVFDALSSMANIAGYK
AVLEASNVFGRFLTGQVTAAGKIPPCKVLVIGAGVAGLSAIATARRMGAIVRGFDTRPAAREQVQSLGAEFIEVE
VQEDGSGAGGYAKEMSDEFIRAEMKLFREQAQDVDIIITTALIPGKPAPKLITKDMLDLMRPGSVVSDLAAEAGG
NCAATVKGELTVYNDIKIIGYTDLPSRLPTQSSTLYSNNITRFLLALSPEKNQFGIDLSDEVVRGAIVTLDGQVL
PPAPRPTPPPVVAKPAAIEAAPLPQPLSPWQSKTREVAAVTAGMSGMLALGKFTGPLFMSNAFTFALASLIGYRV
VWGVVPALHSPLMSVTNAISGMVGVGGLFVLGGGYLPETVPQLFGAASVLLAFVNVSGGFVITKRMLDMFRRPTD
PPEYPWLYGLPALVFGGGFLAAASTGAAGLVQAGYLASTVLCIGSISGLASQATARMGNMLGILGVGSGVLASLL
AVGFSPEVLVQFGGLATIGALAGFLIGKRITPTDLPQTVAALHSVVGLAAVLTSIGSVMANVADVSTLHMVTAYA
GVLVGGITFTGSIVAFLKLAGRMSSRPKLLPGRHAINVGLLATNAATMGAFITMAPGSPAIAAGALAANAALSFI
KGYTTTSAIGGADMPVVITVLNAYSGFALVAEGFMLGNPLLTSVGALIGVSGSILSYVMCVAMNRSLTNVLFGGL
SSPTAVSKYEPEGQVTTTSVDELAEALLGAESVILVVGYGMAVAKAQYAISGIVSSLRSRGVKVRFAIHPVAGRM
PGQCNVLLAEASVPYDIVLEMDEINDDFPDTDLTVVIGANDTVNPISLEKGSAIEGMPVLQAWKSKNVVVMKRSL
ASGYADVPNPMFYMPNTRMLFGDARASCEAIKNAIESKMR
Coding >Ophio5|1758
ATGGTCTCATCCAACGTGCTCGTCTCGGGCTTGCGCCCAGCATCCGCCCGCCTCGCTCTTCGAGCCGCGTCGGTG
ATCTTGTCTCGCAGATGGCTCAGCTCCCCGCACCGTCGCTCCCTTGTGGCCGCCGCTCCAAAGGCCCTAGCTCTG
CTTCGCTACGCACCTTCGCCCTACTACCTCCCGTCGTTGGCTCCGGCCGAGCCCTATTCGACCATCGCCGTTCCG
CCTACGAGGCCCTATGCCCGTCTCGCCGTCGGAGTACCCGCTGAGGTGTTTCCTGGCGAGCGTCGCGTCGCCCTC
ACCCCCGCCAATGTCGCCCTGCTCCTCAACAAGGGCTTTGATCGCCTCATCGTGCAGCGTGGCGCAGGCGCCGCC
GCCGGCTTCCTCGACGAGGCATATGAAAAGGCTGGCGCGACCCTCGTCGACGGTGCCGGCGCTGTCTGGTCCGAC
GCCCAAGTCGTCCTCAAGGTCCGCAGCCCGTCAGCGCAAGAGGTCGACGCCATCAAGGAGAGCCAGGTCGTCATC
TCCTTCTTGCAGCCGGCCCAGAACCACGACCTCGTGCGTCGCATTGCTGAGCGCCGGGCTACGTGCTTCGCCATG
GACATGGTTCCTCGCATCTCGCGCGCCCAGGTCTTCGATGCGCTCAGCAGCATGGCCAACATCGCCGGGTACAAG
GCCGTCCTGGAGGCGTCCAACGTCTTCGGCCGCTTCCTGACGGGTCAGGTAACGGCCGCGGGCAAGATTCCACCC
TGCAAGGTCCTCGTAATCGGCGCCGGCGTCGCTGGTTTGAGTGCCATCGCCACCGCTCGCCGTATGGGTGCCATC
GTCCGTGGCTTCGATACGAGGCCCGCCGCGCGAGAGCAGGTTCAGTCGCTCGGCGCCGAGTTCATCGAAGTTGAA
GTCCAAGAGGACGGCTCCGGCGCCGGCGGCTACGCGAAGGAGATGAGCGACGAATTCATCCGCGCCGAGATGAAG
CTGTTCCGGGAGCAGGCTCAGGACGTCGACATCATCATCACCACGGCCCTCATCCCGGGCAAGCCCGCTCCCAAG
CTCATCACCAAGGACATGCTCGACCTCATGAGGCCCGGTAGCGTCGTCTCGGATCTGGCTGCCGAGGCCGGCGGA
AACTGCGCGGCCACCGTCAAGGGCGAGCTGACCGTGTACAACGACATCAAGATTATTGGATATACCGACCTGCCG
TCTCGCCTGCCGACCCAGTCGTCGACGCTCTACTCCAACAACATCACCAGGTTCCTGTTGGCCTTGTCTCCCGAG
AAAAATCAGTTCGGCATCGATCTATCGGACGAGGTGGTACGCGGCGCCATCGTCACGCTCGACGGCCAAGTCCTG
CCACCGGCTCCGCGTCCTACACCCCCGCCGGTCGTCGCAAAGCCGGCCGCCATCGAGGCCGCCCCTTTGCCCCAG
CCTCTCTCGCCGTGGCAGAGCAAGACGCGCGAGGTCGCCGCCGTTACGGCCGGCATGAGCGGCATGTTGGCTCTC
GGCAAATTTACCGGCCCGCTGTTCATGTCCAACGCCTTCACGTTTGCCCTCGCCAGCCTAATTGGATATCGCGTC
GTCTGGGGCGTCGTCCCGGCCCTGCACTCGCCCCTCATGAGCGTCACCAACGCCATCTCCGGCATGGTCGGCGTC
GGCGGCCTCTTTGTACTTGGAGGCGGATACCTGCCGGAAACGGTGCCGCAGCTATTCGGAGCCGCGAGCGTACTG
CTGGCCTTTGTCAACGTCTCGGGAGGCTTCGTCATCACGAAGCGCATGCTGGACATGTTCAGAAGGCCGACTGAT
CCTCCCGAATACCCCTGGCTGTACGGCCTTCCGGCCCTCGTTTTCGGCGGCGGATTCCTCGCGGCCGCCTCGACG
GGCGCGGCGGGCCTCGTCCAGGCGGGCTACCTCGCCAGCACCGTCCTCTGCATCGGCTCCATCTCGGGCCTCGCG
TCTCAGGCCACGGCACGAATGGGCAATATGCTGGGCATCCTCGGCGTCGGCTCCGGCGTGCTGGCGAGCCTGTTG
GCCGTCGGCTTCTCTCCGGAGGTGCTGGTCCAGTTCGGCGGCCTCGCGACGATAGGCGCCCTCGCAGGCTTCTTA
ATCGGCAAGCGGATCACACCGACGGATCTGCCGCAGACCGTGGCCGCCCTGCACTCGGTCGTCGGCCTGGCGGCT
GTGCTGACCAGCATCGGCAGCGTCATGGCCAACGTAGCGGACGTGTCGACGCTTCACATGGTGACGGCCTACGCC
GGGGTGCTTGTTGGCGGCATAACGTTTACCGGATCCATCGTCGCCTTTCTCAAACTGGCAGGGCGCATGTCTTCG
CGCCCCAAGCTGCTGCCGGGGCGACACGCCATCAACGTGGGCCTGCTGGCGACCAACGCTGCCACCATGGGCGCC
TTCATCACCATGGCGCCCGGCAGTCCCGCGATTGCGGCCGGAGCGCTGGCGGCCAACGCGGCGCTGAGCTTCATC
AAGGGCTATACGACGACATCGGCCATTGGGGGCGCCGACATGCCCGTCGTCATCACAGTCCTCAACGCCTACAGC
GGCTTTGCACTCGTGGCTGAGGGCTTCATGCTCGGCAACCCGCTGCTCACGTCGGTCGGGGCCCTGATCGGCGTA
TCCGGGTCGATCTTGTCGTACGTCATGTGCGTGGCCATGAACCGGTCGCTGACCAACGTCTTGTTCGGCGGCCTA
TCGTCGCCGACGGCGGTCAGCAAGTACGAGCCCGAGGGTCAGGTGACGACGACGTCTGTCGACGAGCTGGCCGAA
GCGCTGCTGGGCGCCGAGTCGGTGATACTGGTCGTCGGCTACGGCATGGCCGTGGCGAAGGCACAGTACGCAATC
TCAGGCATCGTTTCGTCGCTGCGGTCGCGGGGCGTCAAGGTGCGGTTTGCCATCCATCCCGTGGCCGGCCGGATG
CCGGGCCAGTGCAACGTACTGCTCGCCGAGGCCAGCGTGCCTTACGACATTGTGCTGGAGATGGACGAGATAAAC
GATGACTTTCCGGACACGGACCTGACTGTCGTGATCGGGGCCAACGACACGGTCAACCCCATTTCGTTGGAGAAG
GGGAGCGCCATCGAGGGCATGCCTGTGTTGCAGGCATGGAAGAGCAAGAATGTTGTCGTCATGAAGAGGAGCCTT
GCCAGTGGCTACGCTGATGTGCCGAACCCCATGTTTTACATGCCCAACACGCGGATGCTCTTCGGCGACGCGAGG
GCGAGCTGCGAAGCTATCAAGAATGCAATTGAGTCCAAGATGCGG
Transcript >Ophio5|1758
ATGGTCTCATCCAACGTGCTCGTCTCGGGCTTGCGCCCAGCATCCGCCCGCCTCGCTCTTCGAGCCGCGTCGGTG
ATCTTGTCTCGCAGATGGCTCAGCTCCCCGCACCGTCGCTCCCTTGTGGCCGCCGCTCCAAAGGCCCTAGCTCTG
CTTCGCTACGCACCTTCGCCCTACTACCTCCCGTCGTTGGCTCCGGCCGAGCCCTATTCGACCATCGCCGTTCCG
CCTACGAGGCCCTATGCCCGTCTCGCCGTCGGAGTACCCGCTGAGGTGTTTCCTGGCGAGCGTCGCGTCGCCCTC
ACCCCCGCCAATGTCGCCCTGCTCCTCAACAAGGGCTTTGATCGCCTCATCGTGCAGCGTGGCGCAGGCGCCGCC
GCCGGCTTCCTCGACGAGGCATATGAAAAGGCTGGCGCGACCCTCGTCGACGGTGCCGGCGCTGTCTGGTCCGAC
GCCCAAGTCGTCCTCAAGGTCCGCAGCCCGTCAGCGCAAGAGGTCGACGCCATCAAGGAGAGCCAGGTCGTCATC
TCCTTCTTGCAGCCGGCCCAGAACCACGACCTCGTGCGTCGCATTGCTGAGCGCCGGGCTACGTGCTTCGCCATG
GACATGGTTCCTCGCATCTCGCGCGCCCAGGTCTTCGATGCGCTCAGCAGCATGGCCAACATCGCCGGGTACAAG
GCCGTCCTGGAGGCGTCCAACGTCTTCGGCCGCTTCCTGACGGGTCAGGTAACGGCCGCGGGCAAGATTCCACCC
TGCAAGGTCCTCGTAATCGGCGCCGGCGTCGCTGGTTTGAGTGCCATCGCCACCGCTCGCCGTATGGGTGCCATC
GTCCGTGGCTTCGATACGAGGCCCGCCGCGCGAGAGCAGGTTCAGTCGCTCGGCGCCGAGTTCATCGAAGTTGAA
GTCCAAGAGGACGGCTCCGGCGCCGGCGGCTACGCGAAGGAGATGAGCGACGAATTCATCCGCGCCGAGATGAAG
CTGTTCCGGGAGCAGGCTCAGGACGTCGACATCATCATCACCACGGCCCTCATCCCGGGCAAGCCCGCTCCCAAG
CTCATCACCAAGGACATGCTCGACCTCATGAGGCCCGGTAGCGTCGTCTCGGATCTGGCTGCCGAGGCCGGCGGA
AACTGCGCGGCCACCGTCAAGGGCGAGCTGACCGTGTACAACGACATCAAGATTATTGGATATACCGACCTGCCG
TCTCGCCTGCCGACCCAGTCGTCGACGCTCTACTCCAACAACATCACCAGGTTCCTGTTGGCCTTGTCTCCCGAG
AAAAATCAGTTCGGCATCGATCTATCGGACGAGGTGGTACGCGGCGCCATCGTCACGCTCGACGGCCAAGTCCTG
CCACCGGCTCCGCGTCCTACACCCCCGCCGGTCGTCGCAAAGCCGGCCGCCATCGAGGCCGCCCCTTTGCCCCAG
CCTCTCTCGCCGTGGCAGAGCAAGACGCGCGAGGTCGCCGCCGTTACGGCCGGCATGAGCGGCATGTTGGCTCTC
GGCAAATTTACCGGCCCGCTGTTCATGTCCAACGCCTTCACGTTTGCCCTCGCCAGCCTAATTGGATATCGCGTC
GTCTGGGGCGTCGTCCCGGCCCTGCACTCGCCCCTCATGAGCGTCACCAACGCCATCTCCGGCATGGTCGGCGTC
GGCGGCCTCTTTGTACTTGGAGGCGGATACCTGCCGGAAACGGTGCCGCAGCTATTCGGAGCCGCGAGCGTACTG
CTGGCCTTTGTCAACGTCTCGGGAGGCTTCGTCATCACGAAGCGCATGCTGGACATGTTCAGAAGGCCGACTGAT
CCTCCCGAATACCCCTGGCTGTACGGCCTTCCGGCCCTCGTTTTCGGCGGCGGATTCCTCGCGGCCGCCTCGACG
GGCGCGGCGGGCCTCGTCCAGGCGGGCTACCTCGCCAGCACCGTCCTCTGCATCGGCTCCATCTCGGGCCTCGCG
TCTCAGGCCACGGCACGAATGGGCAATATGCTGGGCATCCTCGGCGTCGGCTCCGGCGTGCTGGCGAGCCTGTTG
GCCGTCGGCTTCTCTCCGGAGGTGCTGGTCCAGTTCGGCGGCCTCGCGACGATAGGCGCCCTCGCAGGCTTCTTA
ATCGGCAAGCGGATCACACCGACGGATCTGCCGCAGACCGTGGCCGCCCTGCACTCGGTCGTCGGCCTGGCGGCT
GTGCTGACCAGCATCGGCAGCGTCATGGCCAACGTAGCGGACGTGTCGACGCTTCACATGGTGACGGCCTACGCC
GGGGTGCTTGTTGGCGGCATAACGTTTACCGGATCCATCGTCGCCTTTCTCAAACTGGCAGGGCGCATGTCTTCG
CGCCCCAAGCTGCTGCCGGGGCGACACGCCATCAACGTGGGCCTGCTGGCGACCAACGCTGCCACCATGGGCGCC
TTCATCACCATGGCGCCCGGCAGTCCCGCGATTGCGGCCGGAGCGCTGGCGGCCAACGCGGCGCTGAGCTTCATC
AAGGGCTATACGACGACATCGGCCATTGGGGGCGCCGACATGCCCGTCGTCATCACAGTCCTCAACGCCTACAGC
GGCTTTGCACTCGTGGCTGAGGGCTTCATGCTCGGCAACCCGCTGCTCACGTCGGTCGGGGCCCTGATCGGCGTA
TCCGGGTCGATCTTGTCGTACGTCATGTGCGTGGCCATGAACCGGTCGCTGACCAACGTCTTGTTCGGCGGCCTA
TCGTCGCCGACGGCGGTCAGCAAGTACGAGCCCGAGGGTCAGGTGACGACGACGTCTGTCGACGAGCTGGCCGAA
GCGCTGCTGGGCGCCGAGTCGGTGATACTGGTCGTCGGCTACGGCATGGCCGTGGCGAAGGCACAGTACGCAATC
TCAGGCATCGTTTCGTCGCTGCGGTCGCGGGGCGTCAAGGTGCGGTTTGCCATCCATCCCGTGGCCGGCCGGATG
CCGGGCCAGTGCAACGTACTGCTCGCCGAGGCCAGCGTGCCTTACGACATTGTGCTGGAGATGGACGAGATAAAC
GATGACTTTCCGGACACGGACCTGACTGTCGTGATCGGGGCCAACGACACGGTCAACCCCATTTCGTTGGAGAAG
GGGAGCGCCATCGAGGGCATGCCTGTGTTGCAGGCATGGAAGAGCAAGAATGTTGTCGTCATGAAGAGGAGCCTT
GCCAGTGGCTACGCTGATGTGCCGAACCCCATGTTTTACATGCCCAACACGCGGATGCTCTTCGGCGACGCGAGG
GCGAGCTGCGAAGCTATCAAGAATGCAATTGAGTCCAAGATGCGGTAG
Gene >Ophio5|1758
ATGGTCTCATCCAACGTGCTCGTCTCGGGCTTGCGCCCAGCATCCGCCCGCCTCGCTCTTCGAGGTGCTTTTTTT
CCTACTGAAACCGTCTTCCATAGCCTCGATAGCTGACTCGTCCTCTACTAGCCGCGTCGGTGATCTTGTCTCGCA
GATGGCTCAGCTCCCCGCACCGTCGCTCCCTTGTGGCCGCCGCTCCAAAGGCCCTAGCTCTGCTTCGCTACGCAC
CTTCGCCCTACTACCTCCCGTCGTTGGCTCCGGCCGAGCCCTATTCGACCATCGCCGTTCCGCCTACGAGGCCCT
ATGCCCGTCTCGCCGTCGGAGTACCCGCTGAGGTGTTTCCTGGCGAGCGTCGCGTCGCCCTCACCCCCGCCAATG
TCGCCCTGCTCCTCAACAAGGGCTTTGATCGCCTCATCGTGCAGCGTGGCGCAGGCGCCGCCGCCGGCTTCCTCG
ACGAGGCATATGAAAAGGCTGGCGCGACCCTCGTCGACGGTGCCGGCGCTGTCTGGTCCGACGCCCAAGTCGTCC
TCAAGGTCCGCAGCCCGTCAGCGCAAGAGGTCGACGCCATCAAGGAGAGCCAGGTCGTCATCTCCTTCTTGCAGC
CGGCCCAGAACCACGACCTCGTGCGTCGCATTGCTGAGCGCCGGGCTACGTGCTTCGCCATGGACATGGTTCCTC
GCATCTCGCGCGCCCAGGTCTTCGATGCGCTCAGCAGCATGGCCAACATCGCCGGGTACAAGGCCGTCCTGGAGG
CGTCCAACGTCTTCGGCCGCTTCCTGACGGGTCAGGTAACGGCCGCGGGCAAGATTCCACCCTGCAAGGTCCTCG
TAATCGGCGCCGGCGTCGCTGGTTTGAGTGCCATCGCCACCGCTCGCCGTATGGGTGCCATCGTCCGTGGCTTCG
ATACGAGGCCCGCCGCGCGAGAGCAGGTTCAGTCGCTCGGCGCCGAGTTCATCGAAGTTGAAGTCCAAGAGGACG
GCTCCGGCGCCGGCGGCTACGCGAAGGAGATGAGCGACGAATTCATCCGCGCCGAGATGAAGCTGTTCCGGGAGC
AGGCTCAGGACGTCGACATCATCATCACCACGGCCCTCATCCCGGGCAAGCCCGCTCCCAAGCTCATCACCAAGG
ACATGCTCGACCTCATGAGGCCCGGTAGCGTCGTCTCGGATCTGGCTGCCGAGGCCGGCGGAAACTGCGCGGCCA
CCGTCAAGGGCGAGCTGACCGTGTACAACGACATCAAGATTATTGGTACGTGAGCCGCCTCCAGCCCCTGTGTCT
GACTTTCGGTGGCACTCACCCCAGACTATCAGGATATACCGACCTGCCGTCTCGCCTGCCGACCCAGTCGTCGAC
GCTCTACTCCAACAACATCACCAGGTTCCTGTTGGCCTTGTCTCCCGAGAAAAATCAGTTCGGCATCGATCTATC
GGACGAGGTGGTACGCGGCGCCATCGTCACGCTCGACGGCCAAGTCCTGCCACCGGCTCCGCGTCCTACACCCCC
GCCGGTCGTCGCAAAGCCGGCCGCCATCGAGGCCGCCCCTTTGCCCCAGCCTCTCTCGCCGTGGCAGAGCAAGAC
GCGCGAGGTCGCCGCCGTTACGGCCGGCATGAGCGGCATGTTGGCTCTCGGCAAATTTACCGGCCCGCTGTTCAT
GTCCAACGCCTTCACGTTTGCCCTCGCCAGCCTAATTGGATATCGCGTCGTCTGGGGCGTCGTCCCGGCCCTGCA
CTCGCCCCTCATGAGCGTCACCAACGCCATCTCCGGCATGGTCGGCGTCGGCGGCCTCTTTGTACTTGGAGGCGG
ATACCTGCCGGAAACGGTGCCGCAGCTATTCGGAGCCGCGAGCGTACTGCTGGCCTTTGTCAACGTCTCGGGAGG
CTTCGTCATCACGAAGCGCATGCTGGACATGTTCAGAAGTGAGCTCGACCCTGGCAAGGCGACGACAACGGCCCG
GCCCTGCTGACGCAGCACGCAGGGCCGACTGATCCTCCCGAATACCCCTGGCTGTACGGCCTTCCGGCCCTCGTT
TTCGGCGGCGGATTCCTCGCGGCCGCCTCGACGGGCGCGGCGGGCCTCGTCCAGGCGGGCTACCTCGCCAGCACC
GTCCTCTGCATCGGCTCCATCTCGGGCCTCGCGTCTCAGGCCACGGCACGAATGGGCAATATGCTGGGCATCCTC
GGCGTCGGCTCCGGCGTGCTGGCGAGCCTGTTGGCCGTCGGCTTCTCTCCGGAGGTGCTGGTCCAGTTCGGCGGC
CTCGCGACGATAGGCGCCCTCGCAGGTACAGGTCTTTGGCAGCAGACAGACGGCTTTGGCTGACCGGGACTTTCC
AGGCTTCTTAATCGGCAAGCGGATCACACCGACGGATCTGCCGCAGACCGTGGCCGCCCTGCACTCGGTCGTCGG
CCTGGCGGCTGTGCTGACCAGCATCGGCAGCGTCATGGCCAACGTAGCGGACGTGTCGACGCTTCACATGGTGAC
GGCCTACGCCGGGGTGCTTGTTGGTGGGATTATCCTCCTTGTGCTGTCTTGCGGTTTGTGTGTCTCTCTGTTGAC
TCGATACAAGGCGGCATAACGTTTACCGGATCCATCGTCGCCTTTCTCAAACTGGCAGGGCGCATGTCTTCGCGC
CCCAAGCTGCTGCCGGGGCGACACGCCATCAACGTGGGCCTGCTGGCGACCAACGCTGCCACCATGGGCGCCTTC
ATCACCATGGCGCCCGGCAGTCCCGCGATTGCGGCCGGAGCGCTGGCGGCCAACGCGGCGCTGAGCTTCATCAAG
GGCTATACGACGACATCGGCCATTGGGGGCGCCGACATGCGTGAGTCGATTACTCCTCTCATCAATGGCAGATGC
TGACAAGGACCAGCCGTCGTCATCACAGTCCTCAACGCCTACAGCGGCTTTGCACTCGTGGCTGAGGGCTTCATG
CTCGGCAACCCGCTGCTCACGTCGGTCGGGGCCCTGATCGGCGTATCCGGGTCGATCTTGTCGTACGTCATGTGC
GTGGCCATGAACCGGTCGCTGACCAACGTCTTGTTCGGCGGCCTATCGTCGCCGACGGCGGTCAGCAAGTACGAG
CCCGAGGGTCAGGTGACGACGACGTCTGTCGACGAGCTGGCCGAAGCGCTGCTGGGCGCCGAGTCGGTGATACTG
GTCGTCGGCTACGGCATGGCCGTGGCGAAGGCACAGTACGCAATCTCAGGCATCGTTTCGTCGCTGCGGTCGCGG
GGCGTCAAGGTGCGGTTTGCCATCCATCCCGTGGCCGGCCGGATGCCGGGCCAGTGCAACGTACTGCTCGCCGAG
GCCAGCGTGCCTTACGACATTGTGCTGGAGATGGACGAGATAAACGATGACTTTCCGGACACGGACCTGACTGTC
GTGATCGGGGCCAACGACACGGTCAACCCCATTTCGTTGGAGAAGGGGAGCGCCATCGAGGGCATGCCTGTGTTG
CAGGCATGGAAGAGCAAGAATGTTGTCGTCATGAAGAGGAGCCTTGCCAGTGGCTACGGCAAGTGTCCAGGTGAA
GGAGAGATGAAGATGAGGCTGACGTGGCGCAGCTGATGTGCCGAACCCCATGTTTTACATGCCCAACACGCGGAT
GCTCTTCGGCGACGCGAGGGCGAGCTGCGAAGGTGAGTCGTGACTCGGTCCACGAACAGGGACAAGCTGACAGAC
CATGTGCAGCTATCAAGAATGCAATTGAGTCCAAGATGCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail