Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1749
Gene name
Locationscaffold_166:8654..10988
Strand+
Gene length (bp)2334
Transcript length (bp)2160
Coding sequence length (bp)2157
Protein length (aa) 719

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 5.1E-09 161 203

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59780|YCN3_SCHPO Uncharacterized transcriptional regulatory protein C320.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC320.03 PE=3 SV=1 318 653 5.0E-22
sp|Q750N3|RGT1_ASHGO Glucose transport transcription regulator RGT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RGT1 PE=3 SV=1 154 211 1.0E-15
sp|A6ZZS7|RGT1_YEAS7 Glucose transport transcription regulator RGT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=RGT1 PE=3 SV=1 154 229 1.0E-15
sp|P32862|RGT1_YEAST Glucose transport transcription regulator RGT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT1 PE=1 SV=1 154 229 1.0E-15
sp|B3LR49|RGT1_YEAS1 Glucose transport transcription regulator RGT1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RGT1 PE=3 SV=1 154 229 1.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59780|YCN3_SCHPO Uncharacterized transcriptional regulatory protein C320.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC320.03 PE=3 SV=1 318 653 5.0E-22
sp|Q750N3|RGT1_ASHGO Glucose transport transcription regulator RGT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RGT1 PE=3 SV=1 154 211 1.0E-15
sp|A6ZZS7|RGT1_YEAS7 Glucose transport transcription regulator RGT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=RGT1 PE=3 SV=1 154 229 1.0E-15
sp|P32862|RGT1_YEAST Glucose transport transcription regulator RGT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT1 PE=1 SV=1 154 229 1.0E-15
sp|B3LR49|RGT1_YEAS1 Glucose transport transcription regulator RGT1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RGT1 PE=3 SV=1 154 229 1.0E-15
sp|C7GP35|RGT1_YEAS2 Glucose transport transcription regulator RGT1 OS=Saccharomyces cerevisiae (strain JAY291) GN=RGT1 PE=3 SV=1 154 229 1.0E-15
sp|Q6FLP2|RGT1_CANGA Glucose transport transcription regulator RGT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RGT1 PE=3 SV=1 154 208 4.0E-15
sp|Q6CIL8|RGT1_KLULA Glucose transport transcription regulator RGT1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RGT1 PE=3 SV=1 154 211 6.0E-14
sp|A7TE38|RGT1_VANPO Glucose transport transcription regulator RGT1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RGT1 PE=3 SV=1 158 209 9.0E-13
sp|C5DGQ7|RGT1_LACTC Glucose transport transcription regulator RGT1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=RGT1 PE=3 SV=1 154 211 1.0E-12
sp|C5E4G1|RGT1_ZYGRC Glucose transport transcription regulator RGT1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=RGT1 PE=3 SV=1 154 231 1.0E-12
sp|O59780|YCN3_SCHPO Uncharacterized transcriptional regulatory protein C320.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC320.03 PE=3 SV=1 154 209 6.0E-11
sp|P87000|ACU15_NEUCR Transcriptional activator protein acu-15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-15 PE=1 SV=2 156 584 8.0E-11
sp|O59741|YN25_SCHPO Uncharacterized transcriptional regulatory protein C530.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.05 PE=3 SV=2 143 518 1.0E-10
sp|P36598|THI1_SCHPO Thiamine repressible genes regulatory protein thi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi1 PE=1 SV=2 151 221 4.0E-10
sp|C7GXX9|EDS1_YEAS2 Transcriptional regulatory protein EDS1 OS=Saccharomyces cerevisiae (strain JAY291) GN=EDS1 PE=3 SV=1 154 207 2.0E-08
sp|D3UEC9|EDS1_YEAS8 Transcriptional regulatory protein EDS1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=EDS1 PE=3 SV=1 154 207 2.0E-08
sp|A6ZKX7|EDS1_YEAS7 Transcriptional regulatory protein EDS1 OS=Saccharomyces cerevisiae (strain YJM789) GN=EDS1 PE=3 SV=1 154 207 2.0E-08
sp|B5VDZ9|EDS1_YEAS6 Transcriptional regulatory protein EDS1 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=EDS1 PE=3 SV=1 154 207 2.0E-08
sp|B3LNB2|EDS1_YEAS1 Transcriptional regulatory protein EDS1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=EDS1 PE=3 SV=1 154 207 2.0E-08
sp|P10563|QUTA_EMENI Quinic acid utilization activator OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutA PE=3 SV=2 141 225 2.0E-08
sp|P38073|EDS1_YEAST Transcriptional regulatory protein EDS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EDS1 PE=1 SV=1 154 267 1.0E-07
sp|O94278|THI5_SCHPO Thiamine repressible genes regulatory protein thi5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi5 PE=3 SV=1 136 225 1.0E-07
sp|P40467|ASG1_YEAST Activator of stress genes 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASG1 PE=1 SV=1 155 208 2.0E-07
sp|A1DIC0|XLNR_NEOFI Xylanolytic transcriptional activator xlnR OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xlnR PE=3 SV=2 76 234 4.0E-07
sp|P11638|QA1F_NEUCR Quinic acid utilization activator OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-1f PE=3 SV=2 155 274 2.0E-06
sp|Q2UD93|XLNR_ASPOR Xylanolytic transcriptional activator xlnR OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xlnR PE=1 SV=2 156 235 2.0E-06
sp|B8N6M6|XLNR_ASPFN Xylanolytic transcriptional activator xlnR OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xlnR PE=3 SV=1 156 235 2.0E-06
sp|Q5AVS0|XLNR_EMENI Xylanolytic transcriptional activator xlnR OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnR PE=2 SV=2 156 204 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0008150 biological_process No
GO:0051252 regulation of RNA metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0019222 regulation of metabolic process No
GO:0050794 regulation of cellular process No
GO:0140110 transcription regulator activity No
GO:0031323 regulation of cellular metabolic process No
GO:0065007 biological regulation No
GO:0046872 metal ion binding No
GO:0010468 regulation of gene expression No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0005488 binding No
GO:0080090 regulation of primary metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0050789 regulation of biological process No
GO:0003700 DNA-binding transcription factor activity No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0046914 transition metal ion binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1749
MSPSRQGESEEAPGLHYPSPTTEAMDAGPFYHSNARDGPPEHADHPEQHGQQDVAQDQGQMPPPDSPQHVSRPPN
LEELQLAAQLGDGLAGNPMIPATDPNMNVDEHGMRSIMPHPEPEHHQASPYVHDASTADHMALPVGPPQYQINDG
IPPRKRSKVSRACDECRRKKIKCDAQSDSGENPCSSCARSSIRCLFSRVPQKRGPSKGYIKELADRIHSIENKLE
SEGNLTQDDIDKLFASDRPRSHDQVTPGDDLSRKRPYSSISTGDVNTPVATRQAPWGSEVRPSASSEGFSHEGYA
NSALAPQPSAMKPEVIPSKPPVASMDASMADVDEVLDVDEEALKEYLTTMQPAFPILPSTIWRMQSLLSQCPSSL
REAFRIALVTAAQQGTAGDVKHADALLREWENSDVPSSRASDMVHAQTLLLLSIDADRRELPTLSSLLARAVALA
NSMKLWKLVTVDATDGDSDDALLLKIWWSLILMDRWHAAGTGKPVLIPDSSVVAMAGLAAVVGEICFYLTRLSKV
LVKIANVLSGMPVGATAADANMATMLRDYVEDYREDLPAHVDVTSYPLVHLAYWHCRLLATLLTPGATALEMMWP
ARELSGLLLADGQQRSPLTHHFASLAALCLTKLSKTDKTREEATQLIHDMVEAAPEGQWDGVQAWLAEHMRPPSS
AEATASQGLQHLADLATAHEGMTAADGEVVAFGPALAAGYLGVQ
Coding >Ophio5|1749
ATGAGCCCGAGCAGGCAGGGCGAGTCTGAAGAGGCTCCCGGCCTTCACTACCCGTCGCCAACCACCGAAGCCATG
GACGCGGGGCCGTTTTACCACTCCAACGCCCGCGACGGCCCGCCGGAGCACGCAGACCACCCCGAGCAGCACGGT
CAGCAGGATGTGGCCCAAGACCAGGGCCAGATGCCGCCACCGGACTCGCCGCAACATGTTTCGCGCCCGCCCAAT
CTGGAAGAGCTGCAGCTTGCCGCTCAGCTTGGCGATGGCCTGGCCGGAAACCCCATGATACCGGCTACGGATCCC
AATATGAACGTTGACGAGCACGGCATGCGCAGCATCATGCCTCATCCCGAGCCCGAGCACCACCAGGCCTCCCCA
TATGTGCACGACGCGTCGACTGCAGACCATATGGCTCTGCCCGTGGGTCCGCCTCAGTATCAGATCAACGACGGC
ATCCCGCCGCGGAAACGTTCCAAGGTGTCCCGTGCCTGCGATGAGTGCCGACGCAAGAAAATCAAGTGTGACGCA
CAGTCCGATTCTGGCGAGAATCCATGTTCCAGCTGCGCGCGGTCGTCTATTCGCTGCTTGTTCAGCCGGGTGCCC
CAAAAGCGAGGTCCTAGTAAGGGGTATATCAAGGAACTCGCAGACAGGATCCATAGCATCGAGAATAAGCTCGAG
TCGGAAGGTAACTTGACGCAAGACGACATCGATAAGCTATTCGCCTCCGACCGTCCTCGAAGCCATGACCAGGTC
ACGCCAGGCGATGATCTGAGCCGGAAACGGCCGTATTCAAGCATATCGACAGGCGATGTCAACACTCCGGTGGCG
ACTCGGCAGGCACCCTGGGGCTCGGAAGTTCGACCATCAGCTTCGTCCGAGGGCTTCTCCCATGAAGGGTATGCG
AACAGCGCTCTGGCGCCGCAGCCGTCGGCGATGAAGCCCGAAGTAATTCCGTCGAAGCCGCCTGTGGCCTCGATG
GATGCCTCCATGGCCGACGTCGACGAAGTGCTCGACGTTGACGAGGAGGCCCTGAAGGAGTACCTGACGACGATG
CAACCTGCGTTTCCGATCCTACCCAGCACCATTTGGCGCATGCAGTCGCTGCTGTCACAGTGCCCGTCGTCTCTC
CGGGAAGCGTTCCGCATCGCACTCGTGACGGCGGCGCAACAAGGCACTGCGGGCGATGTCAAGCATGCTGACGCC
CTCTTACGTGAGTGGGAGAACAGTGATGTGCCGAGCAGCCGGGCGTCGGACATGGTGCACGCCCAGACGCTCTTG
CTACTCAGCATAGATGCCGACCGGCGAGAACTTCCGACGCTGTCGTCATTGCTGGCGCGGGCGGTGGCGCTGGCA
AATAGTATGAAGCTCTGGAAGCTCGTGACGGTGGACGCAACAGACGGGGACTCGGACGATGCCCTGTTGCTCAAG
ATCTGGTGGTCGCTGATCCTGATGGACCGCTGGCACGCGGCAGGGACGGGAAAGCCGGTGTTGATTCCCGACAGC
AGTGTTGTGGCGATGGCCGGCCTGGCAGCGGTCGTGGGCGAGATCTGCTTCTATCTAACGAGACTATCCAAGGTT
CTCGTCAAGATTGCAAACGTGCTGTCAGGCATGCCAGTCGGAGCGACGGCGGCAGACGCGAACATGGCGACAATG
CTGAGAGACTACGTGGAGGACTACAGGGAAGATCTTCCGGCGCACGTGGATGTGACATCGTACCCGCTGGTGCAT
CTGGCATACTGGCATTGCCGGCTACTGGCGACGCTGTTGACGCCGGGAGCGACGGCGCTGGAGATGATGTGGCCA
GCGCGGGAGCTCAGTGGTCTGCTGCTGGCGGATGGGCAGCAGCGGAGCCCGCTAACGCACCACTTCGCGTCGTTG
GCGGCGCTGTGCCTGACGAAACTGTCCAAGACGGACAAGACGCGCGAGGAGGCGACGCAGCTCATTCACGACATG
GTGGAGGCGGCGCCGGAGGGCCAGTGGGACGGGGTGCAGGCATGGCTGGCTGAGCATATGCGACCGCCGTCGTCT
GCGGAGGCGACGGCCAGCCAAGGACTGCAGCATCTGGCGGACCTGGCGACGGCGCACGAGGGCATGACGGCAGCC
GACGGCGAGGTGGTTGCCTTTGGGCCGGCCCTGGCGGCGGGCTACTTGGGCGTGCAG
Transcript >Ophio5|1749
ATGAGCCCGAGCAGGCAGGGCGAGTCTGAAGAGGCTCCCGGCCTTCACTACCCGTCGCCAACCACCGAAGCCATG
GACGCGGGGCCGTTTTACCACTCCAACGCCCGCGACGGCCCGCCGGAGCACGCAGACCACCCCGAGCAGCACGGT
CAGCAGGATGTGGCCCAAGACCAGGGCCAGATGCCGCCACCGGACTCGCCGCAACATGTTTCGCGCCCGCCCAAT
CTGGAAGAGCTGCAGCTTGCCGCTCAGCTTGGCGATGGCCTGGCCGGAAACCCCATGATACCGGCTACGGATCCC
AATATGAACGTTGACGAGCACGGCATGCGCAGCATCATGCCTCATCCCGAGCCCGAGCACCACCAGGCCTCCCCA
TATGTGCACGACGCGTCGACTGCAGACCATATGGCTCTGCCCGTGGGTCCGCCTCAGTATCAGATCAACGACGGC
ATCCCGCCGCGGAAACGTTCCAAGGTGTCCCGTGCCTGCGATGAGTGCCGACGCAAGAAAATCAAGTGTGACGCA
CAGTCCGATTCTGGCGAGAATCCATGTTCCAGCTGCGCGCGGTCGTCTATTCGCTGCTTGTTCAGCCGGGTGCCC
CAAAAGCGAGGTCCTAGTAAGGGGTATATCAAGGAACTCGCAGACAGGATCCATAGCATCGAGAATAAGCTCGAG
TCGGAAGGTAACTTGACGCAAGACGACATCGATAAGCTATTCGCCTCCGACCGTCCTCGAAGCCATGACCAGGTC
ACGCCAGGCGATGATCTGAGCCGGAAACGGCCGTATTCAAGCATATCGACAGGCGATGTCAACACTCCGGTGGCG
ACTCGGCAGGCACCCTGGGGCTCGGAAGTTCGACCATCAGCTTCGTCCGAGGGCTTCTCCCATGAAGGGTATGCG
AACAGCGCTCTGGCGCCGCAGCCGTCGGCGATGAAGCCCGAAGTAATTCCGTCGAAGCCGCCTGTGGCCTCGATG
GATGCCTCCATGGCCGACGTCGACGAAGTGCTCGACGTTGACGAGGAGGCCCTGAAGGAGTACCTGACGACGATG
CAACCTGCGTTTCCGATCCTACCCAGCACCATTTGGCGCATGCAGTCGCTGCTGTCACAGTGCCCGTCGTCTCTC
CGGGAAGCGTTCCGCATCGCACTCGTGACGGCGGCGCAACAAGGCACTGCGGGCGATGTCAAGCATGCTGACGCC
CTCTTACGTGAGTGGGAGAACAGTGATGTGCCGAGCAGCCGGGCGTCGGACATGGTGCACGCCCAGACGCTCTTG
CTACTCAGCATAGATGCCGACCGGCGAGAACTTCCGACGCTGTCGTCATTGCTGGCGCGGGCGGTGGCGCTGGCA
AATAGTATGAAGCTCTGGAAGCTCGTGACGGTGGACGCAACAGACGGGGACTCGGACGATGCCCTGTTGCTCAAG
ATCTGGTGGTCGCTGATCCTGATGGACCGCTGGCACGCGGCAGGGACGGGAAAGCCGGTGTTGATTCCCGACAGC
AGTGTTGTGGCGATGGCCGGCCTGGCAGCGGTCGTGGGCGAGATCTGCTTCTATCTAACGAGACTATCCAAGGTT
CTCGTCAAGATTGCAAACGTGCTGTCAGGCATGCCAGTCGGAGCGACGGCGGCAGACGCGAACATGGCGACAATG
CTGAGAGACTACGTGGAGGACTACAGGGAAGATCTTCCGGCGCACGTGGATGTGACATCGTACCCGCTGGTGCAT
CTGGCATACTGGCATTGCCGGCTACTGGCGACGCTGTTGACGCCGGGAGCGACGGCGCTGGAGATGATGTGGCCA
GCGCGGGAGCTCAGTGGTCTGCTGCTGGCGGATGGGCAGCAGCGGAGCCCGCTAACGCACCACTTCGCGTCGTTG
GCGGCGCTGTGCCTGACGAAACTGTCCAAGACGGACAAGACGCGCGAGGAGGCGACGCAGCTCATTCACGACATG
GTGGAGGCGGCGCCGGAGGGCCAGTGGGACGGGGTGCAGGCATGGCTGGCTGAGCATATGCGACCGCCGTCGTCT
GCGGAGGCGACGGCCAGCCAAGGACTGCAGCATCTGGCGGACCTGGCGACGGCGCACGAGGGCATGACGGCAGCC
GACGGCGAGGTGGTTGCCTTTGGGCCGGCCCTGGCGGCGGGCTACTTGGGCGTGCAGTGA
Gene >Ophio5|1749
ATGAGCCCGAGCAGGCAGGGCGAGTCTGAAGAGGCTCCCGGCCTTCACTACCCGTCGCCAACCACCGAAGCCATG
GACGCGGGGCCGTTTTACCACTCCAACGCCCGCGACGGCCCGCCGGAGCACGCAGACCACCCCGAGCAGCACGGT
CAGCAGGATGTGGCCCAAGACCAGGGCCAGATGCCGCCACCGGACTCGCCGCAACATGTTTCGCGCCCGCCCAAT
CTGGAAGAGCTGCAGCTTGCCGCTCAGCTTGGCGATGGCCTGGCCGGAAACCCCATGATACCGGCTACGGATCCC
AATATGAACGTTGACGAGCACGGCATGCGCAGCATCATGCCTCATCCCGAGCCCGAGCACCACCAGGCCTCCCCA
TATGTGCACGACGCGTCGACTGCAGACCATATGGCTCTGCCCGTGGGTCCGCCTCAGTATCAGATCAACGACGGC
ATCCCGCCGCGGAAACGTTCCAAGGTGTCCCGTGCCTGCGATGAGTGCCGACGCAAGAAAATCAAGTGTGACGCA
CAGTCCGATTCTGGCGAGAATCCATGTTCCAGCTGCGCGCGGTCGTCTATTCGCTGCTTGTTCAGCCGGGTGCCC
CAAAAGCGAGGTCCTAGTAAGGGGTAAAGGGTCTCCAATTCCGGCACGAACTGCGTTGCTGGCGGGCTAATCCGG
CTGCAGGTATATCAAGGAACTCGCAGACAGGATCCATAGCATCGAGAATAAGCTCGAGTCGGAAGGTAACTTGAC
GCAAGACGACATCGATAAGCTATTCGCCTCCGACCGTCCTCGAAGCCATGACCAGGTCACGCCAGGCGATGATCT
GAGCCGGAAACGGCCGTATTCAAGCATATCGACAGGCGATGTCAACACTCCGGTGGCGACTCGGCAGGCACCCTG
GGGCTCGGAAGTTCGACCATCAGCTTCGTCCGAGGGCTTCTCCCATGAAGGGTATGCGAACAGCGCTCTGGCGCC
GCAGCCGTCGGCGATGAAGCCCGAAGTAATTCCGTCGAAGCCGCCTGTGGCCTCGATGGATGCCTCCATGGCCGA
CGTCGACGAAGTGCTCGACGTTGACGAGGAGGCCCTGAAGGAGTCAGTCTTGTCCGACACGAAAAAGACTAGTCA
GTCGCTAATGGGCTTTCTCGACAGGTACCTGACGACGATGCAACCTGCGTTTCCGATCCTACCCAGCACCATTTG
GCGCATGCAGTCGCTGCTGTCACAGTGCCCGTCGTCTCTCCGGGAAGCGTTCCGCATCGCACTCGTGACGGCGGC
GCAACAAGGCACTGCGGGCGATGTCAAGCATGCTGACGCCCTCTTACGTGAGTGGGAGAACAGTGATGTGCCGAG
CAGCCGGGCGTCGGACATGGTGCACGCCCAGACGCTCTTGCTACTCAGCATAGATGCCGACCGGCGAGAACTTCC
GACGCTGTCGTCATTGCTGGCGCGGGCGGTGGCGCTGGCAAATAGTATGAAGCTCTGGAAGCTCGTGACGGTGGA
CGCAACAGACGGGGACTCGGACGATGCCCTGTTGCTCAAGATCTGGTGGTCGCTGATCCTGATGGACCGCTGGCA
CGCGGCAGGGACGGGAAAGCCGGTGTTGATTCCCGACAGCAGTGTTGTGGCGATGGCCGGCCTGGCAGCGGTCGT
GGGCGAGATCTGCTTCTATCTAACGAGTGAGTGGCACGCGGGACGGATCCCAAGCGGGCTCGTGAGCTGACGCGG
TGATGAGCAGGACTATCCAAGGTTCTCGTCAAGATTGCAAACGTGCTGTCAGGCATGCCAGTCGGAGCGACGGCG
GCAGACGCGAACATGGCGACAATGCTGAGAGACTACGTGGAGGACTACAGGGAAGATCTTCCGGCGCACGTGGAT
GTGACATCGTACCCGCTGGTGCATCTGGCATACTGGCATTGCCGGCTACTGGCGACGCTGTTGACGCCGGGAGCG
ACGGCGCTGGAGATGATGTGGCCAGCGCGGGAGCTCAGTGGTCTGCTGCTGGCGGATGGGCAGCAGCGGAGCCCG
CTAACGCACCACTTCGCGTCGTTGGCGGCGCTGTGCCTGACGAAACTGTCCAAGACGGACAAGACGCGCGAGGAG
GCGACGCAGCTCATTCACGACATGGTGGAGGCGGCGCCGGAGGGCCAGTGGGACGGGGTGCAGGCATGGCTGGCT
GAGCATATGCGACCGCCGTCGTCTGCGGAGGCGACGGCCAGCCAAGGACTGCAGCATCTGGCGGACCTGGCGACG
GCGCACGAGGGCATGACGGCAGCCGACGGCGAGGTGGTTGCCTTTGGGCCGGCCCTGGCGGCGGGCTACTTGGGC
GTGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail