Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1742
Gene name
Locationscaffold_165:34206..35457
Strand+
Gene length (bp)1251
Transcript length (bp)1251
Coding sequence length (bp)1248
Protein length (aa) 416

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01793 Glyco_transf_15 Glycolipid 2-alpha-mannosyltransferase 2.0E-96 55 355

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94565|OMH4_SCHPO O-glycoside alpha-1,2-mannosyltransferase homolog 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh4 PE=3 SV=2 46 396 6.0E-91
sp|Q96WW1|OMH5_SCHPO O-glycoside alpha-1,2-mannosyltransferase homolog 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh5 PE=3 SV=2 30 396 3.0E-88
sp|P46592|MNT2_CANAL Glycolipid 2-alpha-mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNT2 PE=3 SV=3 61 364 3.0E-82
sp|P27809|KRE2_YEAST Glycolipid 2-alpha-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRE2 PE=1 SV=1 59 395 6.0E-81
sp|P33550|KTR2_YEAST Probable mannosyltransferase KTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR2 PE=3 SV=1 61 361 7.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94565|OMH4_SCHPO O-glycoside alpha-1,2-mannosyltransferase homolog 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh4 PE=3 SV=2 46 396 6.0E-91
sp|Q96WW1|OMH5_SCHPO O-glycoside alpha-1,2-mannosyltransferase homolog 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh5 PE=3 SV=2 30 396 3.0E-88
sp|P46592|MNT2_CANAL Glycolipid 2-alpha-mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNT2 PE=3 SV=3 61 364 3.0E-82
sp|P27809|KRE2_YEAST Glycolipid 2-alpha-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRE2 PE=1 SV=1 59 395 6.0E-81
sp|P33550|KTR2_YEAST Probable mannosyltransferase KTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR2 PE=3 SV=1 61 361 7.0E-79
sp|P53966|KTR5_YEAST Probable mannosyltransferase KTR5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR5 PE=1 SV=1 42 404 8.0E-79
sp|P38130|KTR3_YEAST Probable mannosyltransferase KTR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR3 PE=1 SV=1 52 361 7.0E-77
sp|P26725|YUR1_YEAST Probable mannosyltransferase YUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YUR1 PE=1 SV=1 63 361 2.0E-76
sp|Q00310|MNT1_CANAL Glycolipid 2-alpha-mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNT1 PE=3 SV=1 63 361 7.0E-75
sp|O60160|OMH1_SCHPO O-glycoside alpha-1,2-mannosyltransferase omh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh1 PE=3 SV=1 61 361 1.0E-74
sp|P27810|KTR1_YEAST Alpha-1,2 mannosyltransferase KTR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR1 PE=1 SV=1 8 361 1.0E-74
sp|P40504|KTR7_YEAST Probable mannosyltransferase KTR7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR7 PE=1 SV=1 4 404 3.0E-74
sp|P38131|KTR4_YEAST Probable mannosyltransferase KTR4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR4 PE=1 SV=1 61 376 6.0E-72
sp|O42944|OMH2_SCHPO O-glycoside alpha-1,2-mannosyltransferase homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh2 PE=3 SV=1 54 361 2.0E-71
sp|O74546|OMH3_SCHPO O-glycoside alpha-1,2-mannosyltransferase homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh3 PE=3 SV=1 65 385 2.0E-68
sp|P87207|MNT3_CANAL Probable mannosyltransferase MNT3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNT3 PE=3 SV=1 26 361 7.0E-68
sp|P54070|KTR6_YEAST Mannosyltransferase KTR6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR6 PE=1 SV=1 60 361 2.0E-51
[Show less]

GO

GO Term Description Terminal node
GO:0006486 protein glycosylation Yes
GO:0000030 mannosyltransferase activity Yes
GO:0016020 membrane Yes
GO:0016758 hexosyltransferase activity No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0043412 macromolecule modification No
GO:0070085 glycosylation No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0043413 macromolecule glycosylation No
GO:0016740 transferase activity No
GO:0071704 organic substance metabolic process No
GO:0110165 cellular anatomical entity No
GO:0019538 protein metabolic process No
GO:0005575 cellular_component No
GO:0036211 protein modification process No
GO:0016757 glycosyltransferase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 12 31 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 95.14 51.76 138.51
CcL In ants, during behavior modification 103.60 54.78 152.43
CcD In ants, recently dead 98.23 53.37 143.09

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.760428 no
SC16a CcD 0.911049 no
CcL CcD 0.848844 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1742
MARLLRWRQPVWLRWRLLLVIALLVVLDVWTHRRRLTISRPASNLDPPFHIGCQEPILNGSARAQAVLVMLARNT
DLVGAVASVRSVQRQFNRHFAYPWVFLNDQPWESDFVEAVGEVLAEDSSGARASFETIPADMWGYPDWIDRKKAR
SSMLKMQNRGVRYAGEESYHHMCRFQSGFFYDHPALRGYKWYWRVEPDISFTCAITYDPFVEMERHRKRYGYTMA
LWEGDTTAPSLFHKLSRYKTERRLPASSLWTAMKSPSYLPWPLRRLRRFLPNHDSYGEAWNLCHFWTNFEIADMG
FYRSAEYRRLFHFLDRDGGFYYERWGDAPVHSLAVAMLLRPEEVHHFSDVGYVHDTLQYCPYGPTAESLKRGELV
PKVSGQLDKLRARELGCRCDCATGAKTIRPICFNRIKRTIM
Coding >Ophio5|1742
ATGGCCCGTTTGCTACGCTGGCGGCAGCCCGTCTGGCTGCGGTGGAGGCTGTTGCTCGTTATAGCATTGCTTGTC
GTCTTAGACGTCTGGACGCATCGCCGCCGTCTGACAATTTCTCGACCGGCATCGAACCTCGATCCGCCTTTCCAC
ATCGGTTGTCAGGAGCCGATTCTCAATGGCTCGGCGCGGGCGCAGGCCGTCCTTGTCATGCTCGCCCGGAACACC
GACCTGGTCGGCGCCGTAGCCAGCGTGCGGAGCGTGCAGCGGCAGTTCAACCGTCACTTCGCCTACCCCTGGGTC
TTTCTCAACGATCAGCCGTGGGAGTCTGATTTTGTGGAGGCCGTCGGCGAGGTCTTGGCCGAGGACAGCAGCGGC
GCGCGAGCCAGCTTCGAGACGATTCCCGCCGATATGTGGGGGTATCCGGATTGGATCGACCGAAAGAAGGCTCGG
AGCAGCATGCTCAAGATGCAGAACCGCGGCGTCAGGTACGCCGGCGAGGAGAGCTACCACCACATGTGTCGCTTC
CAGTCGGGCTTCTTTTACGACCACCCGGCTCTGCGAGGCTACAAGTGGTACTGGCGCGTGGAGCCCGACATTTCC
TTTACCTGCGCCATTACATACGATCCGTTCGTCGAGATGGAGCGCCACCGCAAGCGTTACGGCTACACCATGGCT
CTTTGGGAGGGCGACACGACTGCACCTTCTCTTTTCCACAAGCTGTCGCGCTACAAGACCGAGAGGCGGCTTCCC
GCCTCGTCGCTTTGGACGGCCATGAAGAGCCCATCGTACCTCCCGTGGCCGCTGCGGCGTCTACGCAGGTTTCTT
CCGAACCATGACTCGTACGGTGAGGCCTGGAACCTGTGCCACTTCTGGACCAACTTTGAGATTGCCGACATGGGC
TTCTACCGTTCGGCCGAGTACCGTCGTCTGTTTCACTTCCTCGACAGAGACGGCGGTTTCTATTACGAGCGCTGG
GGCGACGCGCCCGTGCATAGCCTCGCCGTCGCCATGCTACTGCGCCCCGAGGAGGTACACCACTTCTCCGACGTG
GGCTACGTGCACGACACGCTCCAGTACTGTCCGTATGGGCCGACAGCCGAATCCCTGAAGCGCGGCGAACTGGTG
CCGAAAGTAAGCGGGCAACTCGACAAGCTGCGGGCGCGGGAGCTGGGATGCCGGTGCGATTGCGCGACGGGGGCT
AAGACAATACGGCCAATATGCTTCAATCGCATCAAACGCACCATCATG
Transcript >Ophio5|1742
ATGGCCCGTTTGCTACGCTGGCGGCAGCCCGTCTGGCTGCGGTGGAGGCTGTTGCTCGTTATAGCATTGCTTGTC
GTCTTAGACGTCTGGACGCATCGCCGCCGTCTGACAATTTCTCGACCGGCATCGAACCTCGATCCGCCTTTCCAC
ATCGGTTGTCAGGAGCCGATTCTCAATGGCTCGGCGCGGGCGCAGGCCGTCCTTGTCATGCTCGCCCGGAACACC
GACCTGGTCGGCGCCGTAGCCAGCGTGCGGAGCGTGCAGCGGCAGTTCAACCGTCACTTCGCCTACCCCTGGGTC
TTTCTCAACGATCAGCCGTGGGAGTCTGATTTTGTGGAGGCCGTCGGCGAGGTCTTGGCCGAGGACAGCAGCGGC
GCGCGAGCCAGCTTCGAGACGATTCCCGCCGATATGTGGGGGTATCCGGATTGGATCGACCGAAAGAAGGCTCGG
AGCAGCATGCTCAAGATGCAGAACCGCGGCGTCAGGTACGCCGGCGAGGAGAGCTACCACCACATGTGTCGCTTC
CAGTCGGGCTTCTTTTACGACCACCCGGCTCTGCGAGGCTACAAGTGGTACTGGCGCGTGGAGCCCGACATTTCC
TTTACCTGCGCCATTACATACGATCCGTTCGTCGAGATGGAGCGCCACCGCAAGCGTTACGGCTACACCATGGCT
CTTTGGGAGGGCGACACGACTGCACCTTCTCTTTTCCACAAGCTGTCGCGCTACAAGACCGAGAGGCGGCTTCCC
GCCTCGTCGCTTTGGACGGCCATGAAGAGCCCATCGTACCTCCCGTGGCCGCTGCGGCGTCTACGCAGGTTTCTT
CCGAACCATGACTCGTACGGTGAGGCCTGGAACCTGTGCCACTTCTGGACCAACTTTGAGATTGCCGACATGGGC
TTCTACCGTTCGGCCGAGTACCGTCGTCTGTTTCACTTCCTCGACAGAGACGGCGGTTTCTATTACGAGCGCTGG
GGCGACGCGCCCGTGCATAGCCTCGCCGTCGCCATGCTACTGCGCCCCGAGGAGGTACACCACTTCTCCGACGTG
GGCTACGTGCACGACACGCTCCAGTACTGTCCGTATGGGCCGACAGCCGAATCCCTGAAGCGCGGCGAACTGGTG
CCGAAAGTAAGCGGGCAACTCGACAAGCTGCGGGCGCGGGAGCTGGGATGCCGGTGCGATTGCGCGACGGGGGCT
AAGACAATACGGCCAATATGCTTCAATCGCATCAAACGCACCATCATGTGA
Gene >Ophio5|1742
ATGGCCCGTTTGCTACGCTGGCGGCAGCCCGTCTGGCTGCGGTGGAGGCTGTTGCTCGTTATAGCATTGCTTGTC
GTCTTAGACGTCTGGACGCATCGCCGCCGTCTGACAATTTCTCGACCGGCATCGAACCTCGATCCGCCTTTCCAC
ATCGGTTGTCAGGAGCCGATTCTCAATGGCTCGGCGCGGGCGCAGGCCGTCCTTGTCATGCTCGCCCGGAACACC
GACCTGGTCGGCGCCGTAGCCAGCGTGCGGAGCGTGCAGCGGCAGTTCAACCGTCACTTCGCCTACCCCTGGGTC
TTTCTCAACGATCAGCCGTGGGAGTCTGATTTTGTGGAGGCCGTCGGCGAGGTCTTGGCCGAGGACAGCAGCGGC
GCGCGAGCCAGCTTCGAGACGATTCCCGCCGATATGTGGGGGTATCCGGATTGGATCGACCGAAAGAAGGCTCGG
AGCAGCATGCTCAAGATGCAGAACCGCGGCGTCAGGTACGCCGGCGAGGAGAGCTACCACCACATGTGTCGCTTC
CAGTCGGGCTTCTTTTACGACCACCCGGCTCTGCGAGGCTACAAGTGGTACTGGCGCGTGGAGCCCGACATTTCC
TTTACCTGCGCCATTACATACGATCCGTTCGTCGAGATGGAGCGCCACCGCAAGCGTTACGGCTACACCATGGCT
CTTTGGGAGGGCGACACGACTGCACCTTCTCTTTTCCACAAGCTGTCGCGCTACAAGACCGAGAGGCGGCTTCCC
GCCTCGTCGCTTTGGACGGCCATGAAGAGCCCATCGTACCTCCCGTGGCCGCTGCGGCGTCTACGCAGGTTTCTT
CCGAACCATGACTCGTACGGTGAGGCCTGGAACCTGTGCCACTTCTGGACCAACTTTGAGATTGCCGACATGGGC
TTCTACCGTTCGGCCGAGTACCGTCGTCTGTTTCACTTCCTCGACAGAGACGGCGGTTTCTATTACGAGCGCTGG
GGCGACGCGCCCGTGCATAGCCTCGCCGTCGCCATGCTACTGCGCCCCGAGGAGGTACACCACTTCTCCGACGTG
GGCTACGTGCACGACACGCTCCAGTACTGTCCGTATGGGCCGACAGCCGAATCCCTGAAGCGCGGCGAACTGGTG
CCGAAAGTAAGCGGGCAACTCGACAAGCTGCGGGCGCGGGAGCTGGGATGCCGGTGCGATTGCGCGACGGGGGCT
AAGACAATACGGCCAATATGCTTCAATCGCATCAAACGCACCATCATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail