Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1733
Gene name
Locationscaffold_165:5858..15527
Strand+
Gene length (bp)9669
Transcript length (bp)9615
Coding sequence length (bp)9612
Protein length (aa) 3204

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20413 Kiaa1109_N Kiaa1109 N-terminal region 3.9E-289 39 1068

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12150|CSF1_YEAST Protein CSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSF1 PE=3 SV=1 17 1151 5.0E-105
sp|Q74ZX0|CSF1_ASHGO Protein CSF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSF1 PE=3 SV=1 32 1152 3.0E-74
sp|Q74ZX0|CSF1_ASHGO Protein CSF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSF1 PE=3 SV=1 2449 3202 1.0E-62
sp|Q12150|CSF1_YEAST Protein CSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSF1 PE=3 SV=1 2447 3201 8.0E-62
sp|A2AAE1|K1109_MOUSE Uncharacterized protein KIAA1109 OS=Mus musculus GN=Kiaa1109 PE=1 SV=4 406 752 7.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12150|CSF1_YEAST Protein CSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSF1 PE=3 SV=1 17 1151 5.0E-105
sp|Q74ZX0|CSF1_ASHGO Protein CSF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSF1 PE=3 SV=1 32 1152 3.0E-74
sp|Q74ZX0|CSF1_ASHGO Protein CSF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSF1 PE=3 SV=1 2449 3202 1.0E-62
sp|Q12150|CSF1_YEAST Protein CSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSF1 PE=3 SV=1 2447 3201 8.0E-62
sp|A2AAE1|K1109_MOUSE Uncharacterized protein KIAA1109 OS=Mus musculus GN=Kiaa1109 PE=1 SV=4 406 752 7.0E-21
sp|Q2LD37|K1109_HUMAN Uncharacterized protein KIAA1109 OS=Homo sapiens GN=KIAA1109 PE=1 SV=2 406 752 1.0E-19
sp|Q12150|CSF1_YEAST Protein CSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSF1 PE=3 SV=1 1262 1701 1.0E-09
sp|Q74ZX0|CSF1_ASHGO Protein CSF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSF1 PE=3 SV=1 1300 1634 5.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 21 40 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1733
MSLVEDVIVARSPENPEYRAVLPVLYIIAALLVIFFLLYFNRVFASIVSYGIRAFTWNQYRIFIDFKALQISLLA
GRIFFTGLRYHGTNETLLVQHGTITWRYWLRRVREVDVHASNGPAEDVGSKQTRNAALPCRINVKLVGLELFIYN
RSPAYDTILAGIVSSGSSGGTSTGVFVGQDEGTVRPRKPDSAEGKDESGAKTEKSGDSSSARSGSDATHHGPAGG
KRDDAQLPFILQLLPIHVDCQKAAIVVGNDTTKAILTAKANSAAVDIDASPTHTCDPYRQIAKVTIDRPVVETRD
NEGFKEDQIARATRRQEDDRVSEPHLHKAFLRRTRRRLLDPLRKIIPWWRRSVEPFSTESRSGAATRASQIPGSA
QWQGLSRYLDDQDQDDKARWTSVEYGAVPTIVDSPQVTLTLFWDVPGRVTEQAHLNGATSSSLDVNGSEPPAWGM
SLSVKGGTVNYGPWTDRQRFALQSMFFPTISKDASPASPLPVGAWRVPTQFTLFIEIEEAATLRIITREESKNWR
WRGKEPATLHKKGPTKRMQWNRAKKNSKGEASHSRPAGWMEMKLPTNSTVAFTTDMLASASGYKTTVNIDLPSAE
LCTSVNHDLLYRCGAQRITCNMPMPLSWNTLRIWHVTVDSDDLDLFLLRDHVFLLSDLITDWAAGAVPDYLQFVP
FEYYLHLNFRNARLIINVNEENIIDKATAPDDNTYMMLSSPRVNVTVHIPIDKFQPDKSAVTFDVRADTPNLVVN
VPQSSTQAAFLPSNDLGVADGLVVSGSFNFNSTVAPGLTDTIVLKVHVQAPHVRLYGFVFRYIVLLRDNIFAEYM
HFKTLGEYLELKKQGAETASRPSNTGMNELDLILAVRVDDPQAMIAGNVYCGDRHIQAELADLSLDLRLNSYIMD
MELSLSPVSLSLGRPVDEVESVSASSSNTQVFVDGLRIFCHRTFGLPGTEQAYLTNWDVGLGAISGECTAEFLAT
LIGLGMSFAFTFDDVENALLPYSMIVFLDLVFARVSVDSFHVWVHIDEAAFLLSTEKIEVISNDWTRSHYSRRTN
IMIPNLQLCCVNAEAATARHTSRRSHAAKTEAYLQTDIQIAIVGRKFHFSAERKVQQDLIRREDQRTGRTQFLLL
GEADSDFVPDTFDPPAQPAPMPPFPITEADVGRLSSRASTQSRLFRGPGHQSSFLSSSSSFDSRNYTKARTKLKG
KRAVFASTPRRAASSHAERRLDAGYDWQRSASRDPAGVFPAKENPDHSSVAFSSQYFAPHFPLESVRADTREAEC
PGIPDESFDGSFWQTEASLDEIDPRSLSEEHSHESTIIEFPSGISAFFRPEALRHALALLADLQPKEPESILDFL
QVGAINEVFGTQKPEHDQGTIQEMLVRIPSADIRILNYATAHPPNDSHQEQDQYDLRLSKLVLLTRTVTEKGAVE
ENSTSANPRTSLHLRLKSAEVSVSERLAPPSNPQEAVILEMDSVVLSLGTKDVTYFDVDVGSVVGSTASGKIDYL
ASLIHRTGNLATDLERLVTDTLASHGNRARYLTYRLLSEGSSTKDPSFFTRPSAVLRSAPKHLRRTDTWKLIMRL
RQIWATMGNRRRSQLATACHDGSLMVPPDAVKTVTAAFERWRSWDLEDAANSVLVKHIFGGDKDNSEVKAGHDFP
LIGACRLGELRLVLDPGPKQNNLGFIDVAVRVEQKPADSSDSVPEMAGFVGPLTVCNIICSEAAVHINWGLCELA
DDLLRLYNRSLASTLGNFEPTEQDTEVARRPLPAVHVAFELMRGSIDLETINLSLKTLSCGLKASILAYSIGDKT
GFVSCILNCNTLTSRLHSNSQLLAIFQLRQASVFVSHELQETQDASLRTIKSAASSQGLTLAVKQDPIALLEVVG
LLVKDEAAQLSRLQAQFTSSPHPPKPIKITDRLSTVRINVALFLGSYTISLSLLQSLTWKISGVVARVACAANYG
KEVIFDFDVKENSHEMQIKVRNEPRSISLLQIPPMNGRIRGHAGGQSDHSFSVLSSIDVIRLDASAIYSLLAVLN
RPQISSAVGEMQQQIKVIQGHVGEVFGSTRPPPPAEPLPARPLLAYDVHVTLVGLRIVAKTALTSKSEPTAQVYF
SLDKTSLMACNQRNPHEPALKYPDLHLKLRHIGLDIRRGKKDAMRSCGSFGTSATVSASSQRGDDGREDWHLNFR
SNELDVNLSPETVSTVIEVVGYLSTKIRDLDTSRELEYLRKLRQPKAQTAVDDQAKPEDEADILGSVLASVVYQF
ELRNIQLCWNAADKSTDKDSAKEDMVLSIQLIEFGTRTRKSARLTISSLLVQTVPPGEDKSVRSLHSALLPEVIF
NAAYVSTAGARRMAFQATGESLDLRLTSAFIVPAANLVDSISLSIHNVQKASAQWTTELMTTPKKADESAEVPQQ
RSFLGNKRLESLLVDADFAGAVVYVTSKNARNNSQSSSGQSWRPPLGGKYSQFNGDDSGSAVVLRSPGLAGKAEY
KDSGRDDPTLYGEVKIDASSNTLHPSVVPLILDIISSVKEVVSDDGNRDTEARKDEAPKLKPERSADEDNILTAD
PTAVLGRLRLNLGLRISRQAFTLSCQPVGRVEATASFDSVYFTVNTVRSLEQGNFFAISGTLSQPQASVQHVYSR
QSTASFGLDTVTVSFMNSKHVSGTSGVSAILKVSPMNVSINAKQAQDFLLFREIWYPKNPRHVAKLETETSQGYL
VQRYQQVAATAAFPWTAVISIAALDVHVDLGQAIGKSVFQISDFWVSSKKTSDWEQNLCLGFQRIGIDCTGRLSG
FIALQSFRMRTSIQWPKREEALNKTPLIHASLAFNACRAKAAFDYQAFLVADITSLDFLMYNVREKRGGSRDRLV
AMLDGEAVQFFGTTASAAQALALFQAVQKLVQEKKESFESSLREIEKYTRRKSATVRATGQPTAVTSPGEDDVAA
KSPISLDTHVMVTLKALNLGVFPATFSDHQVFKMEALNAHARFAANLEQRHIHSVLRMTLGQLRVGLAGVRNAEA
PKSLSEMTVEDVVARATGSRGGTILRVPRVEAMMETWQRPDSNHISYIFKSALEGKVEVGWNYSRISYIRSMWAK
HSKALEQIWGRQLPLTAVKITGVPEAEASAGAEPAAADKDGGGGPPEGGQQKITAEVKVPQSKYEYEALEPPVID
TPQLRDMGEATPPLEWIGLHRDKLPNLTHQMVIVSLLELAGEVEDAYSRILGSS
Coding >Ophio5|1733
ATGTCCCTAGTCGAGGATGTGATCGTGGCCCGATCGCCAGAGAACCCCGAGTACAGGGCCGTGCTCCCTGTACTG
TACATCATCGCCGCCCTGCTCGTCATCTTCTTCCTGCTCTACTTTAATCGAGTCTTCGCCTCCATCGTCTCTTAC
GGCATCAGAGCCTTTACCTGGAATCAGTACCGAATTTTCATCGACTTCAAGGCCTTGCAGATATCCCTTCTGGCC
GGCCGCATCTTCTTCACTGGCCTGCGCTACCACGGCACCAACGAGACTTTACTGGTGCAGCACGGCACGATAACC
TGGCGTTACTGGTTGCGTCGAGTTCGAGAGGTTGACGTCCACGCGTCCAACGGCCCGGCAGAGGACGTGGGCTCT
AAGCAGACGAGAAATGCCGCCCTTCCGTGCCGCATCAACGTCAAGCTCGTGGGCCTCGAGCTTTTCATCTACAAC
CGCAGCCCCGCCTACGACACTATTCTCGCCGGCATTGTCAGTAGCGGCTCCTCCGGCGGAACATCTACCGGCGTC
TTCGTTGGTCAGGACGAGGGCACCGTCAGGCCGAGAAAGCCGGACTCGGCCGAGGGCAAGGATGAATCGGGGGCC
AAAACCGAAAAGTCGGGCGACTCTTCGTCGGCTCGTTCCGGCTCAGATGCAACCCATCACGGTCCTGCCGGCGGC
AAGCGGGATGACGCGCAGCTCCCGTTTATCCTCCAACTGCTTCCCATCCACGTCGATTGTCAAAAGGCCGCCATA
GTCGTAGGCAATGACACGACCAAGGCCATCCTCACGGCCAAGGCCAACTCCGCCGCCGTCGACATTGACGCCTCG
CCCACCCATACGTGCGATCCGTACCGCCAGATTGCCAAGGTGACCATCGATCGACCCGTAGTCGAGACGAGAGAC
AACGAGGGCTTCAAAGAAGACCAAATAGCTCGTGCAACGAGGCGGCAGGAGGATGATCGGGTGTCAGAACCGCAT
CTCCACAAGGCATTTCTAAGACGCACTCGTCGCCGGCTTCTCGATCCCCTGCGAAAGATAATTCCTTGGTGGCGA
CGGTCTGTCGAGCCCTTCTCGACCGAATCGAGGTCCGGCGCGGCAACGAGAGCCTCCCAGATCCCAGGATCGGCC
CAATGGCAAGGTCTCTCCAGATACTTGGACGACCAGGACCAAGACGACAAGGCGCGGTGGACCTCGGTCGAATAC
GGTGCAGTTCCGACCATCGTGGATTCGCCCCAGGTCACATTGACTCTCTTCTGGGATGTGCCTGGCCGCGTCACG
GAGCAAGCCCATCTGAACGGAGCCACGAGTTCGTCGCTCGATGTCAATGGCAGCGAGCCGCCTGCTTGGGGCATG
AGTCTTTCTGTCAAAGGGGGAACGGTAAACTACGGCCCTTGGACGGATCGGCAACGTTTCGCTCTGCAGAGCATG
TTCTTCCCGACAATCTCAAAGGACGCCTCTCCCGCGAGTCCCTTGCCGGTCGGCGCTTGGAGAGTTCCCACCCAG
TTCACGCTGTTTATCGAGATCGAAGAAGCGGCGACTCTGCGCATCATAACGAGAGAGGAGTCCAAGAACTGGCGT
TGGCGCGGAAAGGAGCCGGCAACGCTTCACAAAAAGGGGCCGACCAAGCGCATGCAGTGGAACCGAGCCAAGAAG
AACTCCAAGGGGGAGGCATCCCATTCCAGGCCTGCCGGCTGGATGGAGATGAAGCTCCCGACAAACTCTACCGTG
GCCTTCACGACGGACATGTTGGCCAGCGCCTCGGGATATAAGACGACGGTCAACATTGACCTTCCCAGTGCAGAG
CTCTGCACCAGCGTCAACCACGACTTGCTCTACAGATGCGGAGCGCAACGTATCACCTGCAATATGCCGATGCCA
CTGTCCTGGAACACGCTTCGCATATGGCACGTCACCGTCGACAGCGACGATCTGGACCTGTTCCTACTTCGCGAT
CACGTCTTCCTACTGTCCGACCTCATCACCGATTGGGCCGCCGGGGCTGTTCCGGACTATCTGCAATTCGTGCCT
TTTGAATACTATCTGCATCTGAATTTCCGGAATGCGAGGCTCATCATCAACGTCAACGAAGAGAACATCATCGAC
AAGGCGACCGCCCCGGACGACAACACCTACATGATGCTGTCCAGCCCCCGGGTGAATGTCACCGTCCACATACCG
ATCGACAAGTTCCAGCCAGACAAGAGTGCCGTCACCTTTGACGTGAGGGCCGACACACCAAACTTGGTCGTCAAC
GTTCCGCAGTCGAGCACGCAAGCCGCGTTCCTGCCATCCAATGATCTAGGCGTCGCAGACGGCCTTGTCGTGTCC
GGGAGCTTCAATTTCAACTCGACTGTCGCGCCGGGGCTCACGGACACAATCGTTCTCAAGGTTCACGTGCAAGCG
CCACATGTGCGCCTCTACGGCTTCGTTTTCCGCTACATTGTGCTGCTCAGGGACAACATATTCGCGGAATACATG
CACTTTAAGACTCTGGGCGAGTATCTGGAACTGAAGAAGCAGGGCGCCGAAACGGCGTCGCGCCCCTCGAACACG
GGCATGAATGAGCTCGACCTTATCCTGGCCGTCCGGGTCGACGATCCCCAGGCCATGATCGCGGGCAACGTGTAT
TGCGGCGATCGTCATATACAGGCCGAGCTTGCTGACCTGTCGCTCGACCTTCGTCTCAACAGTTACATCATGGAC
ATGGAACTTTCCTTGAGTCCCGTGAGTCTGTCATTGGGTCGCCCAGTAGACGAGGTCGAGTCTGTGAGCGCGTCC
TCCTCCAACACCCAAGTCTTCGTCGATGGACTGCGGATCTTCTGTCATCGTACCTTTGGATTGCCCGGCACAGAG
CAGGCCTACCTCACCAACTGGGACGTGGGCCTCGGGGCCATCAGCGGCGAATGCACGGCCGAGTTCCTCGCTACC
CTGATAGGACTCGGTATGTCCTTCGCCTTCACGTTTGACGACGTGGAGAACGCTCTGTTACCATATTCGATGATC
GTTTTCCTCGACCTCGTCTTTGCCCGCGTATCGGTCGATTCCTTCCACGTTTGGGTTCACATCGATGAGGCCGCT
TTTCTTCTTTCGACGGAGAAGATTGAGGTTATCAGCAATGACTGGACCCGGTCGCACTACTCCCGGCGCACCAAC
ATCATGATTCCTAACCTGCAGCTGTGCTGCGTCAATGCCGAGGCCGCCACTGCCAGACACACCTCACGACGCTCC
CACGCCGCCAAGACCGAGGCGTACTTGCAAACCGACATTCAGATAGCAATCGTCGGTCGAAAGTTTCACTTCTCC
GCCGAGCGGAAAGTGCAGCAAGACTTGATCCGTCGTGAAGATCAGCGCACTGGGAGGACTCAGTTTCTTCTGCTC
GGTGAGGCGGACAGCGATTTCGTGCCAGATACGTTCGATCCTCCGGCGCAACCCGCTCCGATGCCTCCTTTCCCA
ATCACCGAGGCCGACGTTGGCCGGCTCTCGTCTCGCGCCTCCACACAATCTCGTCTCTTTCGCGGACCAGGCCAT
CAAAGCTCCTTCCTGTCCTCGTCCAGCAGTTTCGATTCGCGAAACTATACTAAGGCTCGCACAAAGCTCAAAGGC
AAAAGGGCCGTCTTTGCCTCGACGCCTCGAAGAGCGGCTTCGTCCCACGCCGAACGGAGGCTGGATGCAGGCTAC
GATTGGCAGCGCTCGGCTTCTCGTGATCCGGCGGGCGTTTTTCCCGCCAAGGAAAATCCTGACCATTCATCCGTT
GCCTTCTCGAGCCAGTATTTCGCCCCGCATTTTCCTCTAGAGAGTGTCCGCGCCGACACTCGTGAGGCTGAGTGT
CCTGGAATCCCGGATGAGAGCTTTGACGGTAGTTTCTGGCAAACAGAAGCATCCTTGGATGAGATTGATCCGCGT
AGCTTGAGCGAGGAGCATTCTCACGAAAGCACCATCATCGAGTTTCCCTCTGGCATATCGGCCTTCTTCAGACCT
GAGGCGTTGCGACACGCCCTCGCACTTCTGGCTGACCTACAGCCGAAAGAACCGGAGAGCATCCTCGACTTCCTC
CAGGTTGGAGCCATTAATGAGGTGTTTGGCACCCAGAAGCCGGAGCATGACCAGGGGACCATCCAGGAGATGCTC
GTGCGGATTCCCAGCGCAGACATACGTATTCTCAACTACGCGACAGCTCATCCCCCCAATGACTCTCACCAAGAG
CAAGACCAATACGACCTGCGGCTTTCCAAACTCGTTTTGCTTACCCGAACAGTCACGGAGAAGGGAGCTGTCGAG
GAGAATTCCACGTCCGCGAACCCGAGGACATCGTTGCATCTTCGACTCAAGTCTGCCGAGGTCTCCGTGTCAGAG
CGTCTTGCCCCGCCATCCAATCCCCAAGAAGCCGTCATTCTGGAGATGGACAGCGTGGTGTTGTCTCTCGGCACA
AAAGACGTCACATACTTTGATGTCGATGTAGGATCAGTGGTTGGCAGTACTGCGTCTGGCAAGATCGACTATCTA
GCTTCTCTCATTCACCGAACGGGTAACCTCGCGACAGATCTGGAACGTCTCGTCACCGACACCTTAGCTAGTCAC
GGCAACCGAGCCAGGTATCTGACATATCGCCTCTTAAGTGAGGGCTCGTCCACAAAAGACCCCTCATTTTTCACG
CGACCATCTGCTGTTCTGAGATCGGCACCCAAGCATCTACGGAGGACTGACACTTGGAAGCTGATCATGCGTCTC
CGCCAAATTTGGGCTACCATGGGAAACCGGAGACGCTCTCAGCTGGCGACGGCGTGTCATGACGGCTCCCTCATG
GTTCCCCCCGATGCTGTCAAAACCGTAACAGCCGCTTTCGAGAGATGGCGCAGCTGGGACTTGGAAGATGCTGCA
AATTCTGTACTGGTCAAGCACATCTTCGGCGGAGACAAGGACAATTCGGAGGTGAAGGCCGGACACGACTTCCCT
CTCATCGGGGCTTGTCGTCTGGGGGAGCTGCGGCTTGTGCTGGATCCGGGACCGAAACAGAATAATCTCGGGTTC
ATCGACGTGGCCGTTCGAGTCGAGCAGAAGCCGGCCGACTCGAGCGACAGCGTACCTGAGATGGCGGGATTCGTC
GGCCCCTTGACGGTTTGTAACATAATCTGCAGCGAAGCGGCCGTGCATATCAACTGGGGGCTTTGCGAACTGGCC
GACGACCTTCTTCGGCTGTACAATCGAAGCCTTGCGAGCACTCTGGGCAACTTTGAACCGACCGAGCAGGACACG
GAGGTTGCCAGAAGGCCCCTTCCGGCAGTTCACGTCGCGTTTGAGCTGATGAGAGGCTCGATCGACCTGGAGACC
ATCAACCTCAGCTTGAAGACGCTGAGCTGCGGACTTAAAGCATCCATCCTGGCTTACAGCATTGGCGACAAGACG
GGCTTTGTGAGCTGCATACTGAACTGCAATACCCTCACTTCGCGGCTTCACAGCAACTCCCAGCTTCTGGCAATC
TTTCAGCTTCGACAAGCGAGTGTCTTTGTGTCACATGAGCTGCAAGAGACGCAAGATGCCTCGCTGCGCACCATC
AAATCGGCGGCTAGCAGCCAAGGCTTGACGCTAGCCGTCAAACAGGATCCCATTGCTTTATTGGAAGTCGTCGGC
CTCCTCGTCAAGGACGAGGCTGCCCAGCTCAGCCGTCTTCAAGCCCAGTTCACGAGCTCGCCGCATCCGCCGAAG
CCCATCAAGATCACGGACCGTCTTTCCACGGTGAGAATCAATGTGGCCTTGTTCCTCGGCAGCTACACCATCAGC
CTCTCGCTGTTGCAGTCGCTCACCTGGAAGATTTCCGGCGTCGTGGCACGAGTCGCATGCGCCGCGAATTATGGC
AAGGAAGTCATCTTCGACTTTGACGTCAAAGAGAATTCGCATGAGATGCAGATCAAGGTCAGAAACGAGCCTCGG
AGCATTTCTCTTCTTCAGATCCCTCCCATGAACGGCCGCATCAGGGGCCACGCAGGGGGTCAGTCGGATCACTCC
TTTTCGGTACTTTCTTCCATCGACGTCATTCGACTGGATGCTTCTGCTATTTACAGCTTGCTCGCAGTTCTCAAC
CGGCCGCAGATATCCAGCGCGGTCGGGGAGATGCAGCAGCAGATCAAGGTCATACAGGGGCACGTTGGGGAGGTC
TTCGGAAGCACGCGTCCGCCGCCACCGGCAGAACCCCTACCGGCTCGTCCGCTGTTAGCGTACGATGTTCACGTC
ACGCTTGTCGGCCTGAGGATAGTTGCCAAAACAGCGCTGACGTCGAAGAGCGAGCCCACGGCCCAGGTTTACTTT
TCGCTGGACAAGACGTCCCTGATGGCCTGCAACCAACGCAATCCGCACGAGCCCGCCCTCAAGTACCCAGATCTG
CATTTGAAATTGCGACATATCGGCCTCGACATCCGCAGGGGCAAGAAGGATGCTATGAGATCATGTGGCAGCTTC
GGTACCAGCGCCACAGTCTCTGCAAGCTCCCAGCGAGGGGACGATGGCAGAGAGGATTGGCACTTGAACTTTCGC
AGTAACGAGTTGGATGTCAACCTGTCACCGGAGACGGTCTCGACGGTGATCGAAGTGGTAGGGTACCTGAGCACG
AAGATTAGGGATCTGGACACGTCGCGGGAGCTCGAGTATCTGAGAAAGCTGAGGCAACCGAAAGCCCAAACCGCC
GTTGACGACCAGGCGAAGCCGGAAGATGAGGCCGACATCCTTGGCTCCGTACTGGCCTCTGTGGTCTACCAGTTT
GAACTGCGGAATATCCAATTGTGCTGGAACGCGGCAGACAAGTCAACAGACAAGGATTCCGCCAAAGAGGACATG
GTTCTGTCGATCCAGCTCATTGAATTTGGGACCAGGACGAGAAAATCGGCGAGGTTGACCATCTCCAGTCTCTTG
GTTCAGACGGTGCCACCAGGTGAAGACAAGAGCGTGCGGTCTTTGCACTCTGCGCTCCTCCCAGAGGTCATCTTC
AACGCGGCATACGTTTCGACAGCGGGAGCACGGCGGATGGCTTTCCAGGCTACGGGCGAGTCGCTCGACCTGCGG
CTGACGTCGGCTTTCATAGTGCCCGCTGCGAATCTCGTCGACTCCATTTCTCTGTCGATCCACAACGTGCAGAAG
GCCTCGGCGCAGTGGACGACGGAACTAATGACGACCCCGAAGAAGGCAGACGAGTCGGCCGAGGTGCCCCAGCAG
CGAAGCTTCCTGGGCAACAAGCGCCTGGAGAGCCTTCTTGTCGACGCCGACTTTGCCGGTGCCGTCGTCTACGTT
ACTAGCAAGAATGCCAGGAACAACTCGCAATCTTCGTCAGGTCAGAGCTGGCGGCCGCCGTTGGGAGGCAAATAC
AGCCAGTTCAACGGGGACGACTCGGGGAGCGCAGTCGTTCTTCGTAGTCCGGGGCTAGCGGGCAAAGCTGAGTAT
AAAGACAGCGGCCGAGACGATCCCACGCTCTACGGCGAGGTCAAGATCGACGCTTCAAGCAACACGTTGCATCCG
TCGGTGGTGCCTCTCATCCTCGACATCATCTCTAGTGTCAAGGAGGTTGTCAGCGATGACGGCAATCGGGATACG
GAAGCTCGGAAGGACGAGGCGCCCAAACTGAAGCCGGAGCGGTCCGCGGATGAGGATAACATTCTCACGGCCGAC
CCCACTGCCGTGTTGGGCCGGCTGAGGCTCAATCTCGGCCTGCGTATCTCCAGACAGGCCTTCACCTTGAGCTGC
CAGCCGGTAGGGCGCGTCGAGGCGACGGCGTCCTTCGACAGCGTCTACTTTACCGTCAACACGGTCCGCTCTCTC
GAGCAGGGTAATTTCTTCGCCATCTCGGGAACGCTGAGCCAGCCGCAAGCCTCCGTGCAGCACGTTTACTCGCGC
CAGTCGACGGCCAGCTTCGGGTTGGACACGGTCACGGTATCGTTCATGAACAGCAAACACGTCAGCGGCACCAGC
GGCGTCTCGGCCATTCTCAAGGTGAGCCCGATGAACGTGTCCATCAACGCGAAGCAGGCCCAGGACTTTCTGCTC
TTCAGGGAGATCTGGTATCCGAAAAACCCGCGCCACGTGGCCAAGCTGGAGACGGAAACGTCTCAGGGGTATCTG
GTGCAGCGATATCAGCAGGTGGCGGCGACGGCGGCATTCCCTTGGACGGCTGTGATATCGATTGCGGCGCTCGAC
GTCCACGTCGATCTGGGACAGGCTATTGGGAAATCAGTCTTCCAGATCAGCGACTTCTGGGTGTCGTCGAAGAAG
ACGTCCGACTGGGAGCAGAACCTGTGTCTCGGCTTTCAACGGATCGGCATCGACTGCACAGGCCGGCTCAGCGGC
TTCATCGCGCTGCAATCCTTCAGAATGCGCACGTCGATCCAGTGGCCGAAGCGAGAAGAAGCCCTGAACAAGACG
CCGCTGATCCACGCATCGCTGGCGTTCAATGCCTGTCGCGCCAAAGCGGCCTTTGATTACCAGGCCTTTCTGGTG
GCGGACATCACGTCGCTCGACTTCCTCATGTACAATGTGCGAGAGAAACGCGGCGGCAGCCGGGACCGGCTAGTG
GCGATGCTCGACGGCGAGGCGGTCCAATTCTTCGGCACGACAGCGTCGGCGGCCCAGGCCTTGGCGCTTTTCCAG
GCCGTACAGAAGCTGGTGCAGGAGAAGAAGGAGAGCTTCGAGTCATCGTTGCGAGAGATTGAGAAGTATACGCGG
CGCAAGTCGGCGACAGTGCGGGCCACGGGTCAACCGACGGCGGTGACGTCGCCTGGCGAGGACGACGTAGCGGCC
AAGTCGCCCATATCTCTGGACACGCATGTCATGGTGACGCTCAAGGCGCTCAACTTGGGCGTGTTTCCGGCAACC
TTTTCGGATCACCAGGTGTTCAAGATGGAGGCGCTCAACGCCCACGCAAGGTTCGCGGCCAATCTGGAGCAGCGA
CACATCCACAGCGTGCTGCGCATGACGCTCGGCCAGCTCCGGGTCGGGCTGGCCGGGGTCCGGAACGCGGAGGCG
CCCAAGTCGCTGAGCGAGATGACGGTCGAGGACGTTGTGGCGCGGGCGACGGGGTCTCGCGGAGGGACCATCCTG
AGGGTGCCACGGGTAGAGGCCATGATGGAGACGTGGCAGCGGCCGGACAGCAACCACATCAGCTACATATTCAAG
AGCGCGCTCGAGGGCAAGGTCGAGGTTGGCTGGAACTACTCGCGTATCAGCTACATCCGCAGCATGTGGGCGAAG
CACTCCAAGGCACTGGAGCAGATATGGGGCCGCCAGCTGCCCTTGACTGCGGTCAAGATCACGGGGGTGCCGGAG
GCAGAGGCGAGTGCCGGGGCCGAGCCGGCGGCGGCGGACAAGGACGGCGGCGGGGGGCCGCCGGAGGGCGGACAG
CAGAAAATCACGGCCGAGGTGAAGGTGCCGCAGTCCAAGTATGAGTACGAGGCGCTGGAGCCTCCGGTCATCGAC
ACGCCGCAGCTTCGCGACATGGGCGAGGCGACGCCGCCGCTAGAGTGGATCGGGCTGCACCGGGACAAGCTGCCC
AACTTGACTCATCAGATGGTTATTGTGTCGCTGCTGGAGCTGGCTGGGGAGGTGGAGGATGCGTATTCGCGCATT
CTGGGTTCGTCG
Transcript >Ophio5|1733
ATGTCCCTAGTCGAGGATGTGATCGTGGCCCGATCGCCAGAGAACCCCGAGTACAGGGCCGTGCTCCCTGTACTG
TACATCATCGCCGCCCTGCTCGTCATCTTCTTCCTGCTCTACTTTAATCGAGTCTTCGCCTCCATCGTCTCTTAC
GGCATCAGAGCCTTTACCTGGAATCAGTACCGAATTTTCATCGACTTCAAGGCCTTGCAGATATCCCTTCTGGCC
GGCCGCATCTTCTTCACTGGCCTGCGCTACCACGGCACCAACGAGACTTTACTGGTGCAGCACGGCACGATAACC
TGGCGTTACTGGTTGCGTCGAGTTCGAGAGGTTGACGTCCACGCGTCCAACGGCCCGGCAGAGGACGTGGGCTCT
AAGCAGACGAGAAATGCCGCCCTTCCGTGCCGCATCAACGTCAAGCTCGTGGGCCTCGAGCTTTTCATCTACAAC
CGCAGCCCCGCCTACGACACTATTCTCGCCGGCATTGTCAGTAGCGGCTCCTCCGGCGGAACATCTACCGGCGTC
TTCGTTGGTCAGGACGAGGGCACCGTCAGGCCGAGAAAGCCGGACTCGGCCGAGGGCAAGGATGAATCGGGGGCC
AAAACCGAAAAGTCGGGCGACTCTTCGTCGGCTCGTTCCGGCTCAGATGCAACCCATCACGGTCCTGCCGGCGGC
AAGCGGGATGACGCGCAGCTCCCGTTTATCCTCCAACTGCTTCCCATCCACGTCGATTGTCAAAAGGCCGCCATA
GTCGTAGGCAATGACACGACCAAGGCCATCCTCACGGCCAAGGCCAACTCCGCCGCCGTCGACATTGACGCCTCG
CCCACCCATACGTGCGATCCGTACCGCCAGATTGCCAAGGTGACCATCGATCGACCCGTAGTCGAGACGAGAGAC
AACGAGGGCTTCAAAGAAGACCAAATAGCTCGTGCAACGAGGCGGCAGGAGGATGATCGGGTGTCAGAACCGCAT
CTCCACAAGGCATTTCTAAGACGCACTCGTCGCCGGCTTCTCGATCCCCTGCGAAAGATAATTCCTTGGTGGCGA
CGGTCTGTCGAGCCCTTCTCGACCGAATCGAGGTCCGGCGCGGCAACGAGAGCCTCCCAGATCCCAGGATCGGCC
CAATGGCAAGGTCTCTCCAGATACTTGGACGACCAGGACCAAGACGACAAGGCGCGGTGGACCTCGGTCGAATAC
GGTGCAGTTCCGACCATCGTGGATTCGCCCCAGGTCACATTGACTCTCTTCTGGGATGTGCCTGGCCGCGTCACG
GAGCAAGCCCATCTGAACGGAGCCACGAGTTCGTCGCTCGATGTCAATGGCAGCGAGCCGCCTGCTTGGGGCATG
AGTCTTTCTGTCAAAGGGGGAACGGTAAACTACGGCCCTTGGACGGATCGGCAACGTTTCGCTCTGCAGAGCATG
TTCTTCCCGACAATCTCAAAGGACGCCTCTCCCGCGAGTCCCTTGCCGGTCGGCGCTTGGAGAGTTCCCACCCAG
TTCACGCTGTTTATCGAGATCGAAGAAGCGGCGACTCTGCGCATCATAACGAGAGAGGAGTCCAAGAACTGGCGT
TGGCGCGGAAAGGAGCCGGCAACGCTTCACAAAAAGGGGCCGACCAAGCGCATGCAGTGGAACCGAGCCAAGAAG
AACTCCAAGGGGGAGGCATCCCATTCCAGGCCTGCCGGCTGGATGGAGATGAAGCTCCCGACAAACTCTACCGTG
GCCTTCACGACGGACATGTTGGCCAGCGCCTCGGGATATAAGACGACGGTCAACATTGACCTTCCCAGTGCAGAG
CTCTGCACCAGCGTCAACCACGACTTGCTCTACAGATGCGGAGCGCAACGTATCACCTGCAATATGCCGATGCCA
CTGTCCTGGAACACGCTTCGCATATGGCACGTCACCGTCGACAGCGACGATCTGGACCTGTTCCTACTTCGCGAT
CACGTCTTCCTACTGTCCGACCTCATCACCGATTGGGCCGCCGGGGCTGTTCCGGACTATCTGCAATTCGTGCCT
TTTGAATACTATCTGCATCTGAATTTCCGGAATGCGAGGCTCATCATCAACGTCAACGAAGAGAACATCATCGAC
AAGGCGACCGCCCCGGACGACAACACCTACATGATGCTGTCCAGCCCCCGGGTGAATGTCACCGTCCACATACCG
ATCGACAAGTTCCAGCCAGACAAGAGTGCCGTCACCTTTGACGTGAGGGCCGACACACCAAACTTGGTCGTCAAC
GTTCCGCAGTCGAGCACGCAAGCCGCGTTCCTGCCATCCAATGATCTAGGCGTCGCAGACGGCCTTGTCGTGTCC
GGGAGCTTCAATTTCAACTCGACTGTCGCGCCGGGGCTCACGGACACAATCGTTCTCAAGGTTCACGTGCAAGCG
CCACATGTGCGCCTCTACGGCTTCGTTTTCCGCTACATTGTGCTGCTCAGGGACAACATATTCGCGGAATACATG
CACTTTAAGACTCTGGGCGAGTATCTGGAACTGAAGAAGCAGGGCGCCGAAACGGCGTCGCGCCCCTCGAACACG
GGCATGAATGAGCTCGACCTTATCCTGGCCGTCCGGGTCGACGATCCCCAGGCCATGATCGCGGGCAACGTGTAT
TGCGGCGATCGTCATATACAGGCCGAGCTTGCTGACCTGTCGCTCGACCTTCGTCTCAACAGTTACATCATGGAC
ATGGAACTTTCCTTGAGTCCCGTGAGTCTGTCATTGGGTCGCCCAGTAGACGAGGTCGAGTCTGTGAGCGCGTCC
TCCTCCAACACCCAAGTCTTCGTCGATGGACTGCGGATCTTCTGTCATCGTACCTTTGGATTGCCCGGCACAGAG
CAGGCCTACCTCACCAACTGGGACGTGGGCCTCGGGGCCATCAGCGGCGAATGCACGGCCGAGTTCCTCGCTACC
CTGATAGGACTCGGTATGTCCTTCGCCTTCACGTTTGACGACGTGGAGAACGCTCTGTTACCATATTCGATGATC
GTTTTCCTCGACCTCGTCTTTGCCCGCGTATCGGTCGATTCCTTCCACGTTTGGGTTCACATCGATGAGGCCGCT
TTTCTTCTTTCGACGGAGAAGATTGAGGTTATCAGCAATGACTGGACCCGGTCGCACTACTCCCGGCGCACCAAC
ATCATGATTCCTAACCTGCAGCTGTGCTGCGTCAATGCCGAGGCCGCCACTGCCAGACACACCTCACGACGCTCC
CACGCCGCCAAGACCGAGGCGTACTTGCAAACCGACATTCAGATAGCAATCGTCGGTCGAAAGTTTCACTTCTCC
GCCGAGCGGAAAGTGCAGCAAGACTTGATCCGTCGTGAAGATCAGCGCACTGGGAGGACTCAGTTTCTTCTGCTC
GGTGAGGCGGACAGCGATTTCGTGCCAGATACGTTCGATCCTCCGGCGCAACCCGCTCCGATGCCTCCTTTCCCA
ATCACCGAGGCCGACGTTGGCCGGCTCTCGTCTCGCGCCTCCACACAATCTCGTCTCTTTCGCGGACCAGGCCAT
CAAAGCTCCTTCCTGTCCTCGTCCAGCAGTTTCGATTCGCGAAACTATACTAAGGCTCGCACAAAGCTCAAAGGC
AAAAGGGCCGTCTTTGCCTCGACGCCTCGAAGAGCGGCTTCGTCCCACGCCGAACGGAGGCTGGATGCAGGCTAC
GATTGGCAGCGCTCGGCTTCTCGTGATCCGGCGGGCGTTTTTCCCGCCAAGGAAAATCCTGACCATTCATCCGTT
GCCTTCTCGAGCCAGTATTTCGCCCCGCATTTTCCTCTAGAGAGTGTCCGCGCCGACACTCGTGAGGCTGAGTGT
CCTGGAATCCCGGATGAGAGCTTTGACGGTAGTTTCTGGCAAACAGAAGCATCCTTGGATGAGATTGATCCGCGT
AGCTTGAGCGAGGAGCATTCTCACGAAAGCACCATCATCGAGTTTCCCTCTGGCATATCGGCCTTCTTCAGACCT
GAGGCGTTGCGACACGCCCTCGCACTTCTGGCTGACCTACAGCCGAAAGAACCGGAGAGCATCCTCGACTTCCTC
CAGGTTGGAGCCATTAATGAGGTGTTTGGCACCCAGAAGCCGGAGCATGACCAGGGGACCATCCAGGAGATGCTC
GTGCGGATTCCCAGCGCAGACATACGTATTCTCAACTACGCGACAGCTCATCCCCCCAATGACTCTCACCAAGAG
CAAGACCAATACGACCTGCGGCTTTCCAAACTCGTTTTGCTTACCCGAACAGTCACGGAGAAGGGAGCTGTCGAG
GAGAATTCCACGTCCGCGAACCCGAGGACATCGTTGCATCTTCGACTCAAGTCTGCCGAGGTCTCCGTGTCAGAG
CGTCTTGCCCCGCCATCCAATCCCCAAGAAGCCGTCATTCTGGAGATGGACAGCGTGGTGTTGTCTCTCGGCACA
AAAGACGTCACATACTTTGATGTCGATGTAGGATCAGTGGTTGGCAGTACTGCGTCTGGCAAGATCGACTATCTA
GCTTCTCTCATTCACCGAACGGGTAACCTCGCGACAGATCTGGAACGTCTCGTCACCGACACCTTAGCTAGTCAC
GGCAACCGAGCCAGGTATCTGACATATCGCCTCTTAAGTGAGGGCTCGTCCACAAAAGACCCCTCATTTTTCACG
CGACCATCTGCTGTTCTGAGATCGGCACCCAAGCATCTACGGAGGACTGACACTTGGAAGCTGATCATGCGTCTC
CGCCAAATTTGGGCTACCATGGGAAACCGGAGACGCTCTCAGCTGGCGACGGCGTGTCATGACGGCTCCCTCATG
GTTCCCCCCGATGCTGTCAAAACCGTAACAGCCGCTTTCGAGAGATGGCGCAGCTGGGACTTGGAAGATGCTGCA
AATTCTGTACTGGTCAAGCACATCTTCGGCGGAGACAAGGACAATTCGGAGGTGAAGGCCGGACACGACTTCCCT
CTCATCGGGGCTTGTCGTCTGGGGGAGCTGCGGCTTGTGCTGGATCCGGGACCGAAACAGAATAATCTCGGGTTC
ATCGACGTGGCCGTTCGAGTCGAGCAGAAGCCGGCCGACTCGAGCGACAGCGTACCTGAGATGGCGGGATTCGTC
GGCCCCTTGACGGTTTGTAACATAATCTGCAGCGAAGCGGCCGTGCATATCAACTGGGGGCTTTGCGAACTGGCC
GACGACCTTCTTCGGCTGTACAATCGAAGCCTTGCGAGCACTCTGGGCAACTTTGAACCGACCGAGCAGGACACG
GAGGTTGCCAGAAGGCCCCTTCCGGCAGTTCACGTCGCGTTTGAGCTGATGAGAGGCTCGATCGACCTGGAGACC
ATCAACCTCAGCTTGAAGACGCTGAGCTGCGGACTTAAAGCATCCATCCTGGCTTACAGCATTGGCGACAAGACG
GGCTTTGTGAGCTGCATACTGAACTGCAATACCCTCACTTCGCGGCTTCACAGCAACTCCCAGCTTCTGGCAATC
TTTCAGCTTCGACAAGCGAGTGTCTTTGTGTCACATGAGCTGCAAGAGACGCAAGATGCCTCGCTGCGCACCATC
AAATCGGCGGCTAGCAGCCAAGGCTTGACGCTAGCCGTCAAACAGGATCCCATTGCTTTATTGGAAGTCGTCGGC
CTCCTCGTCAAGGACGAGGCTGCCCAGCTCAGCCGTCTTCAAGCCCAGTTCACGAGCTCGCCGCATCCGCCGAAG
CCCATCAAGATCACGGACCGTCTTTCCACGGTGAGAATCAATGTGGCCTTGTTCCTCGGCAGCTACACCATCAGC
CTCTCGCTGTTGCAGTCGCTCACCTGGAAGATTTCCGGCGTCGTGGCACGAGTCGCATGCGCCGCGAATTATGGC
AAGGAAGTCATCTTCGACTTTGACGTCAAAGAGAATTCGCATGAGATGCAGATCAAGGTCAGAAACGAGCCTCGG
AGCATTTCTCTTCTTCAGATCCCTCCCATGAACGGCCGCATCAGGGGCCACGCAGGGGGTCAGTCGGATCACTCC
TTTTCGGTACTTTCTTCCATCGACGTCATTCGACTGGATGCTTCTGCTATTTACAGCTTGCTCGCAGTTCTCAAC
CGGCCGCAGATATCCAGCGCGGTCGGGGAGATGCAGCAGCAGATCAAGGTCATACAGGGGCACGTTGGGGAGGTC
TTCGGAAGCACGCGTCCGCCGCCACCGGCAGAACCCCTACCGGCTCGTCCGCTGTTAGCGTACGATGTTCACGTC
ACGCTTGTCGGCCTGAGGATAGTTGCCAAAACAGCGCTGACGTCGAAGAGCGAGCCCACGGCCCAGGTTTACTTT
TCGCTGGACAAGACGTCCCTGATGGCCTGCAACCAACGCAATCCGCACGAGCCCGCCCTCAAGTACCCAGATCTG
CATTTGAAATTGCGACATATCGGCCTCGACATCCGCAGGGGCAAGAAGGATGCTATGAGATCATGTGGCAGCTTC
GGTACCAGCGCCACAGTCTCTGCAAGCTCCCAGCGAGGGGACGATGGCAGAGAGGATTGGCACTTGAACTTTCGC
AGTAACGAGTTGGATGTCAACCTGTCACCGGAGACGGTCTCGACGGTGATCGAAGTGGTAGGGTACCTGAGCACG
AAGATTAGGGATCTGGACACGTCGCGGGAGCTCGAGTATCTGAGAAAGCTGAGGCAACCGAAAGCCCAAACCGCC
GTTGACGACCAGGCGAAGCCGGAAGATGAGGCCGACATCCTTGGCTCCGTACTGGCCTCTGTGGTCTACCAGTTT
GAACTGCGGAATATCCAATTGTGCTGGAACGCGGCAGACAAGTCAACAGACAAGGATTCCGCCAAAGAGGACATG
GTTCTGTCGATCCAGCTCATTGAATTTGGGACCAGGACGAGAAAATCGGCGAGGTTGACCATCTCCAGTCTCTTG
GTTCAGACGGTGCCACCAGGTGAAGACAAGAGCGTGCGGTCTTTGCACTCTGCGCTCCTCCCAGAGGTCATCTTC
AACGCGGCATACGTTTCGACAGCGGGAGCACGGCGGATGGCTTTCCAGGCTACGGGCGAGTCGCTCGACCTGCGG
CTGACGTCGGCTTTCATAGTGCCCGCTGCGAATCTCGTCGACTCCATTTCTCTGTCGATCCACAACGTGCAGAAG
GCCTCGGCGCAGTGGACGACGGAACTAATGACGACCCCGAAGAAGGCAGACGAGTCGGCCGAGGTGCCCCAGCAG
CGAAGCTTCCTGGGCAACAAGCGCCTGGAGAGCCTTCTTGTCGACGCCGACTTTGCCGGTGCCGTCGTCTACGTT
ACTAGCAAGAATGCCAGGAACAACTCGCAATCTTCGTCAGGTCAGAGCTGGCGGCCGCCGTTGGGAGGCAAATAC
AGCCAGTTCAACGGGGACGACTCGGGGAGCGCAGTCGTTCTTCGTAGTCCGGGGCTAGCGGGCAAAGCTGAGTAT
AAAGACAGCGGCCGAGACGATCCCACGCTCTACGGCGAGGTCAAGATCGACGCTTCAAGCAACACGTTGCATCCG
TCGGTGGTGCCTCTCATCCTCGACATCATCTCTAGTGTCAAGGAGGTTGTCAGCGATGACGGCAATCGGGATACG
GAAGCTCGGAAGGACGAGGCGCCCAAACTGAAGCCGGAGCGGTCCGCGGATGAGGATAACATTCTCACGGCCGAC
CCCACTGCCGTGTTGGGCCGGCTGAGGCTCAATCTCGGCCTGCGTATCTCCAGACAGGCCTTCACCTTGAGCTGC
CAGCCGGTAGGGCGCGTCGAGGCGACGGCGTCCTTCGACAGCGTCTACTTTACCGTCAACACGGTCCGCTCTCTC
GAGCAGGGTAATTTCTTCGCCATCTCGGGAACGCTGAGCCAGCCGCAAGCCTCCGTGCAGCACGTTTACTCGCGC
CAGTCGACGGCCAGCTTCGGGTTGGACACGGTCACGGTATCGTTCATGAACAGCAAACACGTCAGCGGCACCAGC
GGCGTCTCGGCCATTCTCAAGGTGAGCCCGATGAACGTGTCCATCAACGCGAAGCAGGCCCAGGACTTTCTGCTC
TTCAGGGAGATCTGGTATCCGAAAAACCCGCGCCACGTGGCCAAGCTGGAGACGGAAACGTCTCAGGGGTATCTG
GTGCAGCGATATCAGCAGGTGGCGGCGACGGCGGCATTCCCTTGGACGGCTGTGATATCGATTGCGGCGCTCGAC
GTCCACGTCGATCTGGGACAGGCTATTGGGAAATCAGTCTTCCAGATCAGCGACTTCTGGGTGTCGTCGAAGAAG
ACGTCCGACTGGGAGCAGAACCTGTGTCTCGGCTTTCAACGGATCGGCATCGACTGCACAGGCCGGCTCAGCGGC
TTCATCGCGCTGCAATCCTTCAGAATGCGCACGTCGATCCAGTGGCCGAAGCGAGAAGAAGCCCTGAACAAGACG
CCGCTGATCCACGCATCGCTGGCGTTCAATGCCTGTCGCGCCAAAGCGGCCTTTGATTACCAGGCCTTTCTGGTG
GCGGACATCACGTCGCTCGACTTCCTCATGTACAATGTGCGAGAGAAACGCGGCGGCAGCCGGGACCGGCTAGTG
GCGATGCTCGACGGCGAGGCGGTCCAATTCTTCGGCACGACAGCGTCGGCGGCCCAGGCCTTGGCGCTTTTCCAG
GCCGTACAGAAGCTGGTGCAGGAGAAGAAGGAGAGCTTCGAGTCATCGTTGCGAGAGATTGAGAAGTATACGCGG
CGCAAGTCGGCGACAGTGCGGGCCACGGGTCAACCGACGGCGGTGACGTCGCCTGGCGAGGACGACGTAGCGGCC
AAGTCGCCCATATCTCTGGACACGCATGTCATGGTGACGCTCAAGGCGCTCAACTTGGGCGTGTTTCCGGCAACC
TTTTCGGATCACCAGGTGTTCAAGATGGAGGCGCTCAACGCCCACGCAAGGTTCGCGGCCAATCTGGAGCAGCGA
CACATCCACAGCGTGCTGCGCATGACGCTCGGCCAGCTCCGGGTCGGGCTGGCCGGGGTCCGGAACGCGGAGGCG
CCCAAGTCGCTGAGCGAGATGACGGTCGAGGACGTTGTGGCGCGGGCGACGGGGTCTCGCGGAGGGACCATCCTG
AGGGTGCCACGGGTAGAGGCCATGATGGAGACGTGGCAGCGGCCGGACAGCAACCACATCAGCTACATATTCAAG
AGCGCGCTCGAGGGCAAGGTCGAGGTTGGCTGGAACTACTCGCGTATCAGCTACATCCGCAGCATGTGGGCGAAG
CACTCCAAGGCACTGGAGCAGATATGGGGCCGCCAGCTGCCCTTGACTGCGGTCAAGATCACGGGGGTGCCGGAG
GCAGAGGCGAGTGCCGGGGCCGAGCCGGCGGCGGCGGACAAGGACGGCGGCGGGGGGCCGCCGGAGGGCGGACAG
CAGAAAATCACGGCCGAGGTGAAGGTGCCGCAGTCCAAGTATGAGTACGAGGCGCTGGAGCCTCCGGTCATCGAC
ACGCCGCAGCTTCGCGACATGGGCGAGGCGACGCCGCCGCTAGAGTGGATCGGGCTGCACCGGGACAAGCTGCCC
AACTTGACTCATCAGATGGTTATTGTGTCGCTGCTGGAGCTGGCTGGGGAGGTGGAGGATGCGTATTCGCGCATT
CTGGGTTCGTCGTGA
Gene >Ophio5|1733
ATGTCCCTAGTCGAGGATGTGATCGTGGCCCGATCGCCAGAGAACCCCGAGTACAGGGCGTGAGCATCCAGCCCT
TCACCCTTCAGGCGTCACCCATCACTGACGTTCCCAAGCGTGCTCCCTGTACTGTACATCATCGCCGCCCTGCTC
GTCATCTTCTTCCTGCTCTACTTTAATCGAGTCTTCGCCTCCATCGTCTCTTACGGCATCAGAGCCTTTACCTGG
AATCAGTACCGAATTTTCATCGACTTCAAGGCCTTGCAGATATCCCTTCTGGCCGGCCGCATCTTCTTCACTGGC
CTGCGCTACCACGGCACCAACGAGACTTTACTGGTGCAGCACGGCACGATAACCTGGCGTTACTGGTTGCGTCGA
GTTCGAGAGGTTGACGTCCACGCGTCCAACGGCCCGGCAGAGGACGTGGGCTCTAAGCAGACGAGAAATGCCGCC
CTTCCGTGCCGCATCAACGTCAAGCTCGTGGGCCTCGAGCTTTTCATCTACAACCGCAGCCCCGCCTACGACACT
ATTCTCGCCGGCATTGTCAGTAGCGGCTCCTCCGGCGGAACATCTACCGGCGTCTTCGTTGGTCAGGACGAGGGC
ACCGTCAGGCCGAGAAAGCCGGACTCGGCCGAGGGCAAGGATGAATCGGGGGCCAAAACCGAAAAGTCGGGCGAC
TCTTCGTCGGCTCGTTCCGGCTCAGATGCAACCCATCACGGTCCTGCCGGCGGCAAGCGGGATGACGCGCAGCTC
CCGTTTATCCTCCAACTGCTTCCCATCCACGTCGATTGTCAAAAGGCCGCCATAGTCGTAGGCAATGACACGACC
AAGGCCATCCTCACGGCCAAGGCCAACTCCGCCGCCGTCGACATTGACGCCTCGCCCACCCATACGTGCGATCCG
TACCGCCAGATTGCCAAGGTGACCATCGATCGACCCGTAGTCGAGACGAGAGACAACGAGGGCTTCAAAGAAGAC
CAAATAGCTCGTGCAACGAGGCGGCAGGAGGATGATCGGGTGTCAGAACCGCATCTCCACAAGGCATTTCTAAGA
CGCACTCGTCGCCGGCTTCTCGATCCCCTGCGAAAGATAATTCCTTGGTGGCGACGGTCTGTCGAGCCCTTCTCG
ACCGAATCGAGGTCCGGCGCGGCAACGAGAGCCTCCCAGATCCCAGGATCGGCCCAATGGCAAGGTCTCTCCAGA
TACTTGGACGACCAGGACCAAGACGACAAGGCGCGGTGGACCTCGGTCGAATACGGTGCAGTTCCGACCATCGTG
GATTCGCCCCAGGTCACATTGACTCTCTTCTGGGATGTGCCTGGCCGCGTCACGGAGCAAGCCCATCTGAACGGA
GCCACGAGTTCGTCGCTCGATGTCAATGGCAGCGAGCCGCCTGCTTGGGGCATGAGTCTTTCTGTCAAAGGGGGA
ACGGTAAACTACGGCCCTTGGACGGATCGGCAACGTTTCGCTCTGCAGAGCATGTTCTTCCCGACAATCTCAAAG
GACGCCTCTCCCGCGAGTCCCTTGCCGGTCGGCGCTTGGAGAGTTCCCACCCAGTTCACGCTGTTTATCGAGATC
GAAGAAGCGGCGACTCTGCGCATCATAACGAGAGAGGAGTCCAAGAACTGGCGTTGGCGCGGAAAGGAGCCGGCA
ACGCTTCACAAAAAGGGGCCGACCAAGCGCATGCAGTGGAACCGAGCCAAGAAGAACTCCAAGGGGGAGGCATCC
CATTCCAGGCCTGCCGGCTGGATGGAGATGAAGCTCCCGACAAACTCTACCGTGGCCTTCACGACGGACATGTTG
GCCAGCGCCTCGGGATATAAGACGACGGTCAACATTGACCTTCCCAGTGCAGAGCTCTGCACCAGCGTCAACCAC
GACTTGCTCTACAGATGCGGAGCGCAACGTATCACCTGCAATATGCCGATGCCACTGTCCTGGAACACGCTTCGC
ATATGGCACGTCACCGTCGACAGCGACGATCTGGACCTGTTCCTACTTCGCGATCACGTCTTCCTACTGTCCGAC
CTCATCACCGATTGGGCCGCCGGGGCTGTTCCGGACTATCTGCAATTCGTGCCTTTTGAATACTATCTGCATCTG
AATTTCCGGAATGCGAGGCTCATCATCAACGTCAACGAAGAGAACATCATCGACAAGGCGACCGCCCCGGACGAC
AACACCTACATGATGCTGTCCAGCCCCCGGGTGAATGTCACCGTCCACATACCGATCGACAAGTTCCAGCCAGAC
AAGAGTGCCGTCACCTTTGACGTGAGGGCCGACACACCAAACTTGGTCGTCAACGTTCCGCAGTCGAGCACGCAA
GCCGCGTTCCTGCCATCCAATGATCTAGGCGTCGCAGACGGCCTTGTCGTGTCCGGGAGCTTCAATTTCAACTCG
ACTGTCGCGCCGGGGCTCACGGACACAATCGTTCTCAAGGTTCACGTGCAAGCGCCACATGTGCGCCTCTACGGC
TTCGTTTTCCGCTACATTGTGCTGCTCAGGGACAACATATTCGCGGAATACATGCACTTTAAGACTCTGGGCGAG
TATCTGGAACTGAAGAAGCAGGGCGCCGAAACGGCGTCGCGCCCCTCGAACACGGGCATGAATGAGCTCGACCTT
ATCCTGGCCGTCCGGGTCGACGATCCCCAGGCCATGATCGCGGGCAACGTGTATTGCGGCGATCGTCATATACAG
GCCGAGCTTGCTGACCTGTCGCTCGACCTTCGTCTCAACAGTTACATCATGGACATGGAACTTTCCTTGAGTCCC
GTGAGTCTGTCATTGGGTCGCCCAGTAGACGAGGTCGAGTCTGTGAGCGCGTCCTCCTCCAACACCCAAGTCTTC
GTCGATGGACTGCGGATCTTCTGTCATCGTACCTTTGGATTGCCCGGCACAGAGCAGGCCTACCTCACCAACTGG
GACGTGGGCCTCGGGGCCATCAGCGGCGAATGCACGGCCGAGTTCCTCGCTACCCTGATAGGACTCGGTATGTCC
TTCGCCTTCACGTTTGACGACGTGGAGAACGCTCTGTTACCATATTCGATGATCGTTTTCCTCGACCTCGTCTTT
GCCCGCGTATCGGTCGATTCCTTCCACGTTTGGGTTCACATCGATGAGGCCGCTTTTCTTCTTTCGACGGAGAAG
ATTGAGGTTATCAGCAATGACTGGACCCGGTCGCACTACTCCCGGCGCACCAACATCATGATTCCTAACCTGCAG
CTGTGCTGCGTCAATGCCGAGGCCGCCACTGCCAGACACACCTCACGACGCTCCCACGCCGCCAAGACCGAGGCG
TACTTGCAAACCGACATTCAGATAGCAATCGTCGGTCGAAAGTTTCACTTCTCCGCCGAGCGGAAAGTGCAGCAA
GACTTGATCCGTCGTGAAGATCAGCGCACTGGGAGGACTCAGTTTCTTCTGCTCGGTGAGGCGGACAGCGATTTC
GTGCCAGATACGTTCGATCCTCCGGCGCAACCCGCTCCGATGCCTCCTTTCCCAATCACCGAGGCCGACGTTGGC
CGGCTCTCGTCTCGCGCCTCCACACAATCTCGTCTCTTTCGCGGACCAGGCCATCAAAGCTCCTTCCTGTCCTCG
TCCAGCAGTTTCGATTCGCGAAACTATACTAAGGCTCGCACAAAGCTCAAAGGCAAAAGGGCCGTCTTTGCCTCG
ACGCCTCGAAGAGCGGCTTCGTCCCACGCCGAACGGAGGCTGGATGCAGGCTACGATTGGCAGCGCTCGGCTTCT
CGTGATCCGGCGGGCGTTTTTCCCGCCAAGGAAAATCCTGACCATTCATCCGTTGCCTTCTCGAGCCAGTATTTC
GCCCCGCATTTTCCTCTAGAGAGTGTCCGCGCCGACACTCGTGAGGCTGAGTGTCCTGGAATCCCGGATGAGAGC
TTTGACGGTAGTTTCTGGCAAACAGAAGCATCCTTGGATGAGATTGATCCGCGTAGCTTGAGCGAGGAGCATTCT
CACGAAAGCACCATCATCGAGTTTCCCTCTGGCATATCGGCCTTCTTCAGACCTGAGGCGTTGCGACACGCCCTC
GCACTTCTGGCTGACCTACAGCCGAAAGAACCGGAGAGCATCCTCGACTTCCTCCAGGTTGGAGCCATTAATGAG
GTGTTTGGCACCCAGAAGCCGGAGCATGACCAGGGGACCATCCAGGAGATGCTCGTGCGGATTCCCAGCGCAGAC
ATACGTATTCTCAACTACGCGACAGCTCATCCCCCCAATGACTCTCACCAAGAGCAAGACCAATACGACCTGCGG
CTTTCCAAACTCGTTTTGCTTACCCGAACAGTCACGGAGAAGGGAGCTGTCGAGGAGAATTCCACGTCCGCGAAC
CCGAGGACATCGTTGCATCTTCGACTCAAGTCTGCCGAGGTCTCCGTGTCAGAGCGTCTTGCCCCGCCATCCAAT
CCCCAAGAAGCCGTCATTCTGGAGATGGACAGCGTGGTGTTGTCTCTCGGCACAAAAGACGTCACATACTTTGAT
GTCGATGTAGGATCAGTGGTTGGCAGTACTGCGTCTGGCAAGATCGACTATCTAGCTTCTCTCATTCACCGAACG
GGTAACCTCGCGACAGATCTGGAACGTCTCGTCACCGACACCTTAGCTAGTCACGGCAACCGAGCCAGGTATCTG
ACATATCGCCTCTTAAGTGAGGGCTCGTCCACAAAAGACCCCTCATTTTTCACGCGACCATCTGCTGTTCTGAGA
TCGGCACCCAAGCATCTACGGAGGACTGACACTTGGAAGCTGATCATGCGTCTCCGCCAAATTTGGGCTACCATG
GGAAACCGGAGACGCTCTCAGCTGGCGACGGCGTGTCATGACGGCTCCCTCATGGTTCCCCCCGATGCTGTCAAA
ACCGTAACAGCCGCTTTCGAGAGATGGCGCAGCTGGGACTTGGAAGATGCTGCAAATTCTGTACTGGTCAAGCAC
ATCTTCGGCGGAGACAAGGACAATTCGGAGGTGAAGGCCGGACACGACTTCCCTCTCATCGGGGCTTGTCGTCTG
GGGGAGCTGCGGCTTGTGCTGGATCCGGGACCGAAACAGAATAATCTCGGGTTCATCGACGTGGCCGTTCGAGTC
GAGCAGAAGCCGGCCGACTCGAGCGACAGCGTACCTGAGATGGCGGGATTCGTCGGCCCCTTGACGGTTTGTAAC
ATAATCTGCAGCGAAGCGGCCGTGCATATCAACTGGGGGCTTTGCGAACTGGCCGACGACCTTCTTCGGCTGTAC
AATCGAAGCCTTGCGAGCACTCTGGGCAACTTTGAACCGACCGAGCAGGACACGGAGGTTGCCAGAAGGCCCCTT
CCGGCAGTTCACGTCGCGTTTGAGCTGATGAGAGGCTCGATCGACCTGGAGACCATCAACCTCAGCTTGAAGACG
CTGAGCTGCGGACTTAAAGCATCCATCCTGGCTTACAGCATTGGCGACAAGACGGGCTTTGTGAGCTGCATACTG
AACTGCAATACCCTCACTTCGCGGCTTCACAGCAACTCCCAGCTTCTGGCAATCTTTCAGCTTCGACAAGCGAGT
GTCTTTGTGTCACATGAGCTGCAAGAGACGCAAGATGCCTCGCTGCGCACCATCAAATCGGCGGCTAGCAGCCAA
GGCTTGACGCTAGCCGTCAAACAGGATCCCATTGCTTTATTGGAAGTCGTCGGCCTCCTCGTCAAGGACGAGGCT
GCCCAGCTCAGCCGTCTTCAAGCCCAGTTCACGAGCTCGCCGCATCCGCCGAAGCCCATCAAGATCACGGACCGT
CTTTCCACGGTGAGAATCAATGTGGCCTTGTTCCTCGGCAGCTACACCATCAGCCTCTCGCTGTTGCAGTCGCTC
ACCTGGAAGATTTCCGGCGTCGTGGCACGAGTCGCATGCGCCGCGAATTATGGCAAGGAAGTCATCTTCGACTTT
GACGTCAAAGAGAATTCGCATGAGATGCAGATCAAGGTCAGAAACGAGCCTCGGAGCATTTCTCTTCTTCAGATC
CCTCCCATGAACGGCCGCATCAGGGGCCACGCAGGGGGTCAGTCGGATCACTCCTTTTCGGTACTTTCTTCCATC
GACGTCATTCGACTGGATGCTTCTGCTATTTACAGCTTGCTCGCAGTTCTCAACCGGCCGCAGATATCCAGCGCG
GTCGGGGAGATGCAGCAGCAGATCAAGGTCATACAGGGGCACGTTGGGGAGGTCTTCGGAAGCACGCGTCCGCCG
CCACCGGCAGAACCCCTACCGGCTCGTCCGCTGTTAGCGTACGATGTTCACGTCACGCTTGTCGGCCTGAGGATA
GTTGCCAAAACAGCGCTGACGTCGAAGAGCGAGCCCACGGCCCAGGTTTACTTTTCGCTGGACAAGACGTCCCTG
ATGGCCTGCAACCAACGCAATCCGCACGAGCCCGCCCTCAAGTACCCAGATCTGCATTTGAAATTGCGACATATC
GGCCTCGACATCCGCAGGGGCAAGAAGGATGCTATGAGATCATGTGGCAGCTTCGGTACCAGCGCCACAGTCTCT
GCAAGCTCCCAGCGAGGGGACGATGGCAGAGAGGATTGGCACTTGAACTTTCGCAGTAACGAGTTGGATGTCAAC
CTGTCACCGGAGACGGTCTCGACGGTGATCGAAGTGGTAGGGTACCTGAGCACGAAGATTAGGGATCTGGACACG
TCGCGGGAGCTCGAGTATCTGAGAAAGCTGAGGCAACCGAAAGCCCAAACCGCCGTTGACGACCAGGCGAAGCCG
GAAGATGAGGCCGACATCCTTGGCTCCGTACTGGCCTCTGTGGTCTACCAGTTTGAACTGCGGAATATCCAATTG
TGCTGGAACGCGGCAGACAAGTCAACAGACAAGGATTCCGCCAAAGAGGACATGGTTCTGTCGATCCAGCTCATT
GAATTTGGGACCAGGACGAGAAAATCGGCGAGGTTGACCATCTCCAGTCTCTTGGTTCAGACGGTGCCACCAGGT
GAAGACAAGAGCGTGCGGTCTTTGCACTCTGCGCTCCTCCCAGAGGTCATCTTCAACGCGGCATACGTTTCGACA
GCGGGAGCACGGCGGATGGCTTTCCAGGCTACGGGCGAGTCGCTCGACCTGCGGCTGACGTCGGCTTTCATAGTG
CCCGCTGCGAATCTCGTCGACTCCATTTCTCTGTCGATCCACAACGTGCAGAAGGCCTCGGCGCAGTGGACGACG
GAACTAATGACGACCCCGAAGAAGGCAGACGAGTCGGCCGAGGTGCCCCAGCAGCGAAGCTTCCTGGGCAACAAG
CGCCTGGAGAGCCTTCTTGTCGACGCCGACTTTGCCGGTGCCGTCGTCTACGTTACTAGCAAGAATGCCAGGAAC
AACTCGCAATCTTCGTCAGGTCAGAGCTGGCGGCCGCCGTTGGGAGGCAAATACAGCCAGTTCAACGGGGACGAC
TCGGGGAGCGCAGTCGTTCTTCGTAGTCCGGGGCTAGCGGGCAAAGCTGAGTATAAAGACAGCGGCCGAGACGAT
CCCACGCTCTACGGCGAGGTCAAGATCGACGCTTCAAGCAACACGTTGCATCCGTCGGTGGTGCCTCTCATCCTC
GACATCATCTCTAGTGTCAAGGAGGTTGTCAGCGATGACGGCAATCGGGATACGGAAGCTCGGAAGGACGAGGCG
CCCAAACTGAAGCCGGAGCGGTCCGCGGATGAGGATAACATTCTCACGGCCGACCCCACTGCCGTGTTGGGCCGG
CTGAGGCTCAATCTCGGCCTGCGTATCTCCAGACAGGCCTTCACCTTGAGCTGCCAGCCGGTAGGGCGCGTCGAG
GCGACGGCGTCCTTCGACAGCGTCTACTTTACCGTCAACACGGTCCGCTCTCTCGAGCAGGGTAATTTCTTCGCC
ATCTCGGGAACGCTGAGCCAGCCGCAAGCCTCCGTGCAGCACGTTTACTCGCGCCAGTCGACGGCCAGCTTCGGG
TTGGACACGGTCACGGTATCGTTCATGAACAGCAAACACGTCAGCGGCACCAGCGGCGTCTCGGCCATTCTCAAG
GTGAGCCCGATGAACGTGTCCATCAACGCGAAGCAGGCCCAGGACTTTCTGCTCTTCAGGGAGATCTGGTATCCG
AAAAACCCGCGCCACGTGGCCAAGCTGGAGACGGAAACGTCTCAGGGGTATCTGGTGCAGCGATATCAGCAGGTG
GCGGCGACGGCGGCATTCCCTTGGACGGCTGTGATATCGATTGCGGCGCTCGACGTCCACGTCGATCTGGGACAG
GCTATTGGGAAATCAGTCTTCCAGATCAGCGACTTCTGGGTGTCGTCGAAGAAGACGTCCGACTGGGAGCAGAAC
CTGTGTCTCGGCTTTCAACGGATCGGCATCGACTGCACAGGCCGGCTCAGCGGCTTCATCGCGCTGCAATCCTTC
AGAATGCGCACGTCGATCCAGTGGCCGAAGCGAGAAGAAGCCCTGAACAAGACGCCGCTGATCCACGCATCGCTG
GCGTTCAATGCCTGTCGCGCCAAAGCGGCCTTTGATTACCAGGCCTTTCTGGTGGCGGACATCACGTCGCTCGAC
TTCCTCATGTACAATGTGCGAGAGAAACGCGGCGGCAGCCGGGACCGGCTAGTGGCGATGCTCGACGGCGAGGCG
GTCCAATTCTTCGGCACGACAGCGTCGGCGGCCCAGGCCTTGGCGCTTTTCCAGGCCGTACAGAAGCTGGTGCAG
GAGAAGAAGGAGAGCTTCGAGTCATCGTTGCGAGAGATTGAGAAGTATACGCGGCGCAAGTCGGCGACAGTGCGG
GCCACGGGTCAACCGACGGCGGTGACGTCGCCTGGCGAGGACGACGTAGCGGCCAAGTCGCCCATATCTCTGGAC
ACGCATGTCATGGTGACGCTCAAGGCGCTCAACTTGGGCGTGTTTCCGGCAACCTTTTCGGATCACCAGGTGTTC
AAGATGGAGGCGCTCAACGCCCACGCAAGGTTCGCGGCCAATCTGGAGCAGCGACACATCCACAGCGTGCTGCGC
ATGACGCTCGGCCAGCTCCGGGTCGGGCTGGCCGGGGTCCGGAACGCGGAGGCGCCCAAGTCGCTGAGCGAGATG
ACGGTCGAGGACGTTGTGGCGCGGGCGACGGGGTCTCGCGGAGGGACCATCCTGAGGGTGCCACGGGTAGAGGCC
ATGATGGAGACGTGGCAGCGGCCGGACAGCAACCACATCAGCTACATATTCAAGAGCGCGCTCGAGGGCAAGGTC
GAGGTTGGCTGGAACTACTCGCGTATCAGCTACATCCGCAGCATGTGGGCGAAGCACTCCAAGGCACTGGAGCAG
ATATGGGGCCGCCAGCTGCCCTTGACTGCGGTCAAGATCACGGGGGTGCCGGAGGCAGAGGCGAGTGCCGGGGCC
GAGCCGGCGGCGGCGGACAAGGACGGCGGCGGGGGGCCGCCGGAGGGCGGACAGCAGAAAATCACGGCCGAGGTG
AAGGTGCCGCAGTCCAAGTATGAGTACGAGGCGCTGGAGCCTCCGGTCATCGACACGCCGCAGCTTCGCGACATG
GGCGAGGCGACGCCGCCGCTAGAGTGGATCGGGCTGCACCGGGACAAGCTGCCCAACTTGACTCATCAGATGGTT
ATTGTGTCGCTGCTGGAGCTGGCTGGGGAGGTGGAGGATGCGTATTCGCGCATTCTGGGTTCGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail