Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1728
Gene name
Locationscaffold_164:33627..34614
Strand-
Gene length (bp)987
Transcript length (bp)987
Coding sequence length (bp)984
Protein length (aa) 328

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02089 Palm_thioest Palmitoyl protein thioesterase 1.7E-84 46 300

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50897|PPT1_HUMAN Palmitoyl-protein thioesterase 1 OS=Homo sapiens GN=PPT1 PE=1 SV=1 43 317 7.0E-55
sp|O88531|PPT1_MOUSE Palmitoyl-protein thioesterase 1 OS=Mus musculus GN=Ppt1 PE=1 SV=2 43 303 2.0E-54
sp|Q8HXW6|PPT1_MACFA Palmitoyl-protein thioesterase 1 OS=Macaca fascicularis GN=PPT1 PE=2 SV=1 44 317 4.0E-54
sp|P45478|PPT1_BOVIN Palmitoyl-protein thioesterase 1 OS=Bos taurus GN=PPT1 PE=1 SV=1 43 303 7.0E-53
sp|P45479|PPT1_RAT Palmitoyl-protein thioesterase 1 OS=Rattus norvegicus GN=Ppt1 PE=1 SV=1 43 303 5.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50897|PPT1_HUMAN Palmitoyl-protein thioesterase 1 OS=Homo sapiens GN=PPT1 PE=1 SV=1 43 317 7.0E-55
sp|O88531|PPT1_MOUSE Palmitoyl-protein thioesterase 1 OS=Mus musculus GN=Ppt1 PE=1 SV=2 43 303 2.0E-54
sp|Q8HXW6|PPT1_MACFA Palmitoyl-protein thioesterase 1 OS=Macaca fascicularis GN=PPT1 PE=2 SV=1 44 317 4.0E-54
sp|P45478|PPT1_BOVIN Palmitoyl-protein thioesterase 1 OS=Bos taurus GN=PPT1 PE=1 SV=1 43 303 7.0E-53
sp|P45479|PPT1_RAT Palmitoyl-protein thioesterase 1 OS=Rattus norvegicus GN=Ppt1 PE=1 SV=1 43 303 5.0E-52
sp|Q20390|PPT1_CAEEL Palmitoyl-protein thioesterase 1 OS=Caenorhabditis elegans GN=ppt-1 PE=2 SV=2 40 316 1.0E-50
sp|Q9W3C7|PPT1_DROME Palmitoyl-protein thioesterase 1 OS=Drosophila melanogaster GN=Ppt1 PE=1 SV=2 40 303 2.0E-41
sp|Q54CM0|PPT3_DICDI Palmitoyl-protein thioesterase 3 OS=Dictyostelium discoideum GN=ppt3 PE=3 SV=1 46 316 8.0E-37
sp|O59747|PDF1_SCHPO Palmitoyl-protein thioesterase-dolichyl pyrophosphate phosphatase fusion 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdf1 PE=1 SV=2 41 303 1.0E-35
sp|Q6GNY7|PPT2B_XENLA Lysosomal thioesterase PPT2-B OS=Xenopus laevis GN=ppt2-b PE=2 SV=1 40 298 4.0E-13
sp|Q9VKH6|PPT2_DROME Lysosomal thioesterase PPT2 homolog OS=Drosophila melanogaster GN=Ppt2 PE=2 SV=1 46 291 8.0E-12
sp|Q6PCJ9|PPT2A_XENLA Lysosomal thioesterase PPT2-A OS=Xenopus laevis GN=ppt2-a PE=2 SV=1 46 298 3.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1728
MAPRPPLLVALFLTLTSCATSSIIQLVSSGAKDGHPRDWTSTTPLPLLIWHGLGDNFASPGMEEIASVATSIHPD
TLVYTISLGGQDASADRSATFFGNVSAQLEDVCKALANHSVLATAPAVDALGLSQGGQFMRGFVERCNVPPVRSL
VTFGSQHNGIAQFKECAPMDWLCGAAMLLLKHNTWSNLVQSRLVPAQYFRDPTDYHSYLEHSNYLADINNERSVK
NETYRANLASLTSFVLYMFDHDETVIPRETSWFAEVNGSDVVPLRERRLYTEDWLGLRKLDQKGALHFRSIAGDH
MDIPSHVLNDTMAEFFGPLRISDAPGEL
Coding >Ophio5|1728
ATGGCGCCGCGACCGCCCCTCCTCGTCGCCCTCTTTCTCACCCTCACCTCATGCGCAACCTCCTCCATCATCCAG
CTCGTCAGCTCCGGGGCCAAAGACGGCCACCCACGAGACTGGACCTCGACGACGCCTCTTCCCCTACTGATCTGG
CACGGTCTAGGCGATAACTTCGCCAGTCCCGGCATGGAAGAAATCGCCTCGGTCGCGACGTCGATTCATCCGGAC
ACGCTCGTTTATACCATCAGCCTCGGCGGCCAAGACGCGAGCGCAGATCGATCGGCCACCTTCTTCGGAAACGTC
TCCGCCCAGCTCGAAGACGTGTGCAAGGCGCTCGCAAACCATAGCGTATTGGCTACCGCGCCTGCCGTCGACGCC
TTGGGACTTTCGCAGGGTGGCCAGTTTATGCGCGGCTTTGTTGAGCGCTGTAATGTGCCTCCTGTTCGCAGCCTC
GTCACCTTCGGCAGTCAGCACAATGGCATCGCCCAGTTCAAGGAGTGCGCTCCCATGGATTGGCTTTGTGGTGCT
GCCATGTTGCTCCTGAAGCATAATACGTGGAGTAACCTCGTTCAGAGCCGGCTCGTTCCCGCACAGTACTTTCGC
GATCCGACTGATTATCACTCTTACCTCGAGCATTCCAACTATTTGGCTGATATCAACAACGAGCGATCCGTCAAG
AACGAGACGTATCGCGCCAATCTTGCTAGCTTGACTAGCTTCGTCCTCTACATGTTCGATCACGACGAGACTGTT
ATCCCCAGGGAGACGTCGTGGTTCGCCGAAGTCAACGGCTCTGATGTCGTGCCCCTGCGCGAGCGTCGCCTCTAT
ACTGAAGATTGGCTGGGCTTGCGCAAGCTGGATCAAAAGGGCGCGCTGCATTTTAGGTCCATTGCAGGGGATCAC
ATGGATATTCCAAGTCATGTTCTCAACGACACCATGGCCGAGTTCTTTGGGCCTTTGCGCATTTCCGATGCGCCC
GGCGAGCTG
Transcript >Ophio5|1728
ATGGCGCCGCGACCGCCCCTCCTCGTCGCCCTCTTTCTCACCCTCACCTCATGCGCAACCTCCTCCATCATCCAG
CTCGTCAGCTCCGGGGCCAAAGACGGCCACCCACGAGACTGGACCTCGACGACGCCTCTTCCCCTACTGATCTGG
CACGGTCTAGGCGATAACTTCGCCAGTCCCGGCATGGAAGAAATCGCCTCGGTCGCGACGTCGATTCATCCGGAC
ACGCTCGTTTATACCATCAGCCTCGGCGGCCAAGACGCGAGCGCAGATCGATCGGCCACCTTCTTCGGAAACGTC
TCCGCCCAGCTCGAAGACGTGTGCAAGGCGCTCGCAAACCATAGCGTATTGGCTACCGCGCCTGCCGTCGACGCC
TTGGGACTTTCGCAGGGTGGCCAGTTTATGCGCGGCTTTGTTGAGCGCTGTAATGTGCCTCCTGTTCGCAGCCTC
GTCACCTTCGGCAGTCAGCACAATGGCATCGCCCAGTTCAAGGAGTGCGCTCCCATGGATTGGCTTTGTGGTGCT
GCCATGTTGCTCCTGAAGCATAATACGTGGAGTAACCTCGTTCAGAGCCGGCTCGTTCCCGCACAGTACTTTCGC
GATCCGACTGATTATCACTCTTACCTCGAGCATTCCAACTATTTGGCTGATATCAACAACGAGCGATCCGTCAAG
AACGAGACGTATCGCGCCAATCTTGCTAGCTTGACTAGCTTCGTCCTCTACATGTTCGATCACGACGAGACTGTT
ATCCCCAGGGAGACGTCGTGGTTCGCCGAAGTCAACGGCTCTGATGTCGTGCCCCTGCGCGAGCGTCGCCTCTAT
ACTGAAGATTGGCTGGGCTTGCGCAAGCTGGATCAAAAGGGCGCGCTGCATTTTAGGTCCATTGCAGGGGATCAC
ATGGATATTCCAAGTCATGTTCTCAACGACACCATGGCCGAGTTCTTTGGGCCTTTGCGCATTTCCGATGCGCCC
GGCGAGCTGTAA
Gene >Ophio5|1728
ATGGCGCCGCGACCGCCCCTCCTCGTCGCCCTCTTTCTCACCCTCACCTCATGCGCAACCTCCTCCATCATCCAG
CTCGTCAGCTCCGGGGCCAAAGACGGCCACCCACGAGACTGGACCTCGACGACGCCTCTTCCCCTACTGATCTGG
CACGGTCTAGGCGATAACTTCGCCAGTCCCGGCATGGAAGAAATCGCCTCGGTCGCGACGTCGATTCATCCGGAC
ACGCTCGTTTATACCATCAGCCTCGGCGGCCAAGACGCGAGCGCAGATCGATCGGCCACCTTCTTCGGAAACGTC
TCCGCCCAGCTCGAAGACGTGTGCAAGGCGCTCGCAAACCATAGCGTATTGGCTACCGCGCCTGCCGTCGACGCC
TTGGGACTTTCGCAGGGTGGCCAGTTTATGCGCGGCTTTGTTGAGCGCTGTAATGTGCCTCCTGTTCGCAGCCTC
GTCACCTTCGGCAGTCAGCACAATGGCATCGCCCAGTTCAAGGAGTGCGCTCCCATGGATTGGCTTTGTGGTGCT
GCCATGTTGCTCCTGAAGCATAATACGTGGAGTAACCTCGTTCAGAGCCGGCTCGTTCCCGCACAGTACTTTCGC
GATCCGACTGATTATCACTCTTACCTCGAGCATTCCAACTATTTGGCTGATATCAACAACGAGCGATCCGTCAAG
AACGAGACGTATCGCGCCAATCTTGCTAGCTTGACTAGCTTCGTCCTCTACATGTTCGATCACGACGAGACTGTT
ATCCCCAGGGAGACGTCGTGGTTCGCCGAAGTCAACGGCTCTGATGTCGTGCCCCTGCGCGAGCGTCGCCTCTAT
ACTGAAGATTGGCTGGGCTTGCGCAAGCTGGATCAAAAGGGCGCGCTGCATTTTAGGTCCATTGCAGGGGATCAC
ATGGATATTCCAAGTCATGTTCTCAACGACACCATGGCCGAGTTCTTTGGGCCTTTGCGCATTTCCGATGCGCCC
GGCGAGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail