Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1721
Gene name
Locationscaffold_164:12391..15455
Strand-
Gene length (bp)3064
Transcript length (bp)2784
Coding sequence length (bp)2781
Protein length (aa) 927

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10291 muHD Muniscin C-terminal mu homology domain 2.1E-55 655 926

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P25623|SYP1_YEAST Suppressor of yeast profilin deletion OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYP1 PE=1 SV=3 589 926 6.0E-17
sp|O43059|SYP1_SCHPO Cytoskeletal protein syp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syp1 PE=1 SV=1 1 233 1.0E-13
sp|P25623|SYP1_YEAST Suppressor of yeast profilin deletion OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYP1 PE=1 SV=3 6 246 8.0E-08

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.6821 0.3238 0.062 0.2939 0.0519 0.001 0.156 0.3746 0.4925 0.0033

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup538
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6603
Ophiocordyceps australis map64 (Brazil) OphauB2|8106
Ophiocordyceps camponoti-floridani Ophcf2|06279
Ophiocordyceps camponoti-rufipedis Ophun1|3074
Ophiocordyceps camponoti-rufipedis Ophun1|4973
Ophiocordyceps kimflemingae Ophio5|1721 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3612
Ophiocordyceps subramaniannii Hirsu2|4185

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1721
MDDLARAEYPGLLATMMPGQAVLTLSERIKRINRINLEIADWLQERRRVEEQYALGLRRLAQHRVPNSNSELGVF
HAPWMRILESVDRIAKSHHLFAERIEKDVEYPLRAYQQRRDYQNMHNISSNLAVLARDLDDAQDKAEKLNRRGGK
ANSQKVEAATTRLESAAQQWESQAPFVFETLQVVDESRVNQLRDLLTQYQTQEASQAQRAQDNAVEALAAMLEIS
TDKEIKDFARRAAENKLPLPSQPMHSSHPNPVRSVTRRLSMAAAPLHRPLTASAPPPPPPPPPPVVAPAGHPTGA
PAAAPTAATAGSTTGAASLGPPPAGANPPPPPAEDGVSDHDSFPADAKPESKLRRLGTMFGNRRRQSVYGGGSGP
ITPQRTGPAAFGRSTTSHSRGVSPRPSMSNLHQDHGRLSALDEMPNRLEHDAPATDDSGPPHAGTNGVSAGGENP
PHLSATGAAADLVGMNGTHDVDVAAVPPPPGPPPGQQAAEGGPLSPAQDLEGYTVRAPMNDPISEAQREAAGEDA
DQLLKLNIQNKPIDEEDPEAKQAALSSVANTLKAGTATRRSSTFRGRRDIRNTIYLPTPTSSIRESQSDGAMPSI
TGSPPLTSSSFSRPTPVAALASETSVAGTSDSQSVRSGNSLGSMGHVRHPDMTGPGLHGSVIETVSAVFEDGEVK
SAAITGEIAFVNNVSQAGGKTHETIRIKTVPRLERLGPNRIFVQNSSAEQPQQFVLDVSPLARTMTAFSYRVCSG
ESDSPDLGSRVPLLLKPAWKPQGEKLGLLLQYQLNPSAQLSGSLTLHNVVFVVTYEGNATTAQTKPGGTHLRDKH
LVYCRLGDVTLTSSVQKMVCLIVGADGVAPTPGHVEARWECVTAGTDAVGSGISISRLEEDGEKSAAATEDDPFA
DHGLAAGQSWVDVPLQRRLISGKYEGK
Coding >Ophio5|1721
ATGGACGACCTTGCCAGGGCCGAGTATCCCGGCCTTCTGGCCACCATGATGCCCGGCCAAGCTGTCTTGACCCTC
AGCGAACGGATCAAGCGCATCAACAGAATCAATCTCGAGATTGCCGACTGGCTTCAGGAGCGTCGTCGCGTCGAG
GAGCAGTATGCCCTCGGCCTGCGCAGGCTCGCCCAGCATAGAGTCCCCAACTCTAACTCGGAATTAGGAGTCTTT
CACGCCCCTTGGATGCGAATCCTCGAGTCGGTCGATCGCATCGCAAAGTCGCACCACCTGTTCGCCGAGCGCATC
GAAAAGGATGTCGAATACCCCTTGCGAGCCTACCAGCAGCGCCGCGACTATCAAAATATGCACAACATCTCCTCC
AACCTCGCCGTCTTGGCCAGGGACCTCGACGATGCCCAGGACAAGGCGGAAAAGCTTAACAGGAGGGGCGGCAAG
GCCAACTCTCAAAAAGTCGAAGCCGCCACCACCAGGCTCGAGTCGGCCGCTCAGCAGTGGGAGTCCCAGGCCCCG
TTCGTCTTCGAGACGCTGCAGGTCGTCGACGAGTCGCGCGTCAACCAGCTCCGTGACCTCCTGACGCAGTATCAG
ACGCAGGAGGCCTCCCAGGCCCAGCGCGCTCAGGACAATGCCGTCGAAGCCTTGGCTGCCATGCTCGAGATAAGC
ACTGACAAGGAAATCAAAGACTTTGCAAGACGAGCGGCCGAAAACAAGCTGCCGCTGCCTTCGCAACCGATGCAC
TCGTCACACCCCAACCCTGTTCGCTCCGTCACGAGACGCTTGTCCATGGCTGCAGCGCCTCTTCACCGGCCACTC
ACCGCGTCTGCGCCGCCGCCGCCACCACCACCACCGCCTCCAGTCGTCGCACCGGCTGGACATCCGACCGGAGCG
CCGGCTGCCGCACCGACCGCCGCGACGGCTGGCTCGACGACCGGCGCAGCCTCGTTGGGACCTCCGCCGGCGGGC
GCCAACCCCCCTCCGCCTCCCGCCGAGGACGGCGTTAGCGACCACGATTCCTTCCCAGCTGACGCCAAGCCAGAA
TCCAAACTGCGACGCCTCGGGACCATGTTCGGGAACCGACGGCGGCAGAGCGTCTACGGGGGTGGTTCCGGCCCC
ATCACGCCTCAGAGGACGGGCCCAGCCGCCTTTGGGCGCTCGACCACCTCCCACAGCCGAGGCGTCTCTCCGAGG
CCGTCGATGAGCAATCTTCACCAGGACCACGGCCGACTGTCCGCCCTCGACGAGATGCCAAACCGGCTCGAACAT
GACGCGCCAGCCACAGACGACAGCGGGCCTCCCCACGCGGGAACAAACGGGGTGTCGGCCGGTGGTGAAAATCCG
CCGCACCTCTCCGCGACCGGCGCCGCTGCCGACCTCGTTGGCATGAACGGGACCCACGACGTGGATGTGGCGGCC
GTACCTCCACCGCCCGGCCCGCCTCCGGGACAGCAGGCGGCTGAAGGGGGGCCTTTGTCGCCGGCCCAGGACCTC
GAGGGCTACACCGTGCGGGCGCCCATGAACGATCCCATCTCCGAGGCTCAGCGGGAGGCTGCTGGCGAGGATGCC
GATCAGCTCCTCAAACTCAACATCCAGAACAAGCCCATCGATGAAGAAGACCCCGAGGCCAAGCAGGCTGCCCTA
TCCAGCGTCGCCAACACGCTCAAGGCCGGGACGGCGACCCGCCGCTCCAGCACCTTCCGGGGACGCCGCGATATC
CGCAACACCATCTACCTCCCGACCCCTACATCGAGCATACGCGAGAGCCAATCCGACGGAGCGATGCCGTCCATC
ACGGGCTCACCCCCCCTGACGTCTTCTTCCTTCTCCCGCCCGACGCCCGTGGCGGCACTGGCGTCGGAAACCAGC
GTCGCCGGCACGTCCGACTCGCAGTCGGTGCGGTCCGGCAACTCGCTGGGCAGCATGGGTCATGTCAGGCATCCC
GACATGACCGGCCCGGGCCTTCACGGCTCCGTCATCGAGACCGTCTCTGCCGTGTTTGAGGACGGAGAGGTCAAG
AGCGCAGCCATCACGGGCGAGATTGCCTTTGTGAATAACGTTTCTCAGGCAGGCGGAAAGACACACGAGACAATA
CGGATCAAGACGGTCCCGAGACTCGAGCGCCTCGGCCCCAACCGCATCTTCGTCCAGAACTCATCGGCAGAGCAG
CCGCAACAGTTTGTGCTCGACGTCTCTCCCCTGGCAAGGACGATGACGGCCTTCTCGTACCGCGTCTGCTCCGGC
GAGTCTGATTCCCCTGACCTCGGCTCGCGCGTGCCGCTGCTGCTGAAGCCGGCGTGGAAGCCACAGGGCGAGAAG
CTGGGACTCCTTCTGCAGTACCAACTCAACCCATCGGCGCAGCTGTCGGGCTCCCTGACGCTCCACAATGTCGTC
TTCGTCGTCACGTACGAGGGGAACGCGACGACGGCGCAGACGAAGCCCGGCGGGACGCACCTGCGGGACAAGCAT
CTGGTCTACTGCCGCCTGGGCGACGTGACGCTTACGAGCAGCGTGCAGAAGATGGTGTGTCTCATCGTCGGGGCC
GACGGCGTAGCCCCGACGCCCGGCCACGTCGAGGCCCGATGGGAGTGTGTCACTGCTGGAACCGATGCCGTGGGG
AGCGGCATCTCAATCTCGAGGCTGGAGGAGGATGGCGAGAAGAGCGCGGCGGCGACCGAGGACGATCCATTCGCT
GATCATGGCCTTGCCGCGGGCCAGAGCTGGGTGGACGTGCCGCTACAGAGGAGGCTCATCAGCGGCAAGTACGAG
GGCAAA
Transcript >Ophio5|1721
ATGGACGACCTTGCCAGGGCCGAGTATCCCGGCCTTCTGGCCACCATGATGCCCGGCCAAGCTGTCTTGACCCTC
AGCGAACGGATCAAGCGCATCAACAGAATCAATCTCGAGATTGCCGACTGGCTTCAGGAGCGTCGTCGCGTCGAG
GAGCAGTATGCCCTCGGCCTGCGCAGGCTCGCCCAGCATAGAGTCCCCAACTCTAACTCGGAATTAGGAGTCTTT
CACGCCCCTTGGATGCGAATCCTCGAGTCGGTCGATCGCATCGCAAAGTCGCACCACCTGTTCGCCGAGCGCATC
GAAAAGGATGTCGAATACCCCTTGCGAGCCTACCAGCAGCGCCGCGACTATCAAAATATGCACAACATCTCCTCC
AACCTCGCCGTCTTGGCCAGGGACCTCGACGATGCCCAGGACAAGGCGGAAAAGCTTAACAGGAGGGGCGGCAAG
GCCAACTCTCAAAAAGTCGAAGCCGCCACCACCAGGCTCGAGTCGGCCGCTCAGCAGTGGGAGTCCCAGGCCCCG
TTCGTCTTCGAGACGCTGCAGGTCGTCGACGAGTCGCGCGTCAACCAGCTCCGTGACCTCCTGACGCAGTATCAG
ACGCAGGAGGCCTCCCAGGCCCAGCGCGCTCAGGACAATGCCGTCGAAGCCTTGGCTGCCATGCTCGAGATAAGC
ACTGACAAGGAAATCAAAGACTTTGCAAGACGAGCGGCCGAAAACAAGCTGCCGCTGCCTTCGCAACCGATGCAC
TCGTCACACCCCAACCCTGTTCGCTCCGTCACGAGACGCTTGTCCATGGCTGCAGCGCCTCTTCACCGGCCACTC
ACCGCGTCTGCGCCGCCGCCGCCACCACCACCACCGCCTCCAGTCGTCGCACCGGCTGGACATCCGACCGGAGCG
CCGGCTGCCGCACCGACCGCCGCGACGGCTGGCTCGACGACCGGCGCAGCCTCGTTGGGACCTCCGCCGGCGGGC
GCCAACCCCCCTCCGCCTCCCGCCGAGGACGGCGTTAGCGACCACGATTCCTTCCCAGCTGACGCCAAGCCAGAA
TCCAAACTGCGACGCCTCGGGACCATGTTCGGGAACCGACGGCGGCAGAGCGTCTACGGGGGTGGTTCCGGCCCC
ATCACGCCTCAGAGGACGGGCCCAGCCGCCTTTGGGCGCTCGACCACCTCCCACAGCCGAGGCGTCTCTCCGAGG
CCGTCGATGAGCAATCTTCACCAGGACCACGGCCGACTGTCCGCCCTCGACGAGATGCCAAACCGGCTCGAACAT
GACGCGCCAGCCACAGACGACAGCGGGCCTCCCCACGCGGGAACAAACGGGGTGTCGGCCGGTGGTGAAAATCCG
CCGCACCTCTCCGCGACCGGCGCCGCTGCCGACCTCGTTGGCATGAACGGGACCCACGACGTGGATGTGGCGGCC
GTACCTCCACCGCCCGGCCCGCCTCCGGGACAGCAGGCGGCTGAAGGGGGGCCTTTGTCGCCGGCCCAGGACCTC
GAGGGCTACACCGTGCGGGCGCCCATGAACGATCCCATCTCCGAGGCTCAGCGGGAGGCTGCTGGCGAGGATGCC
GATCAGCTCCTCAAACTCAACATCCAGAACAAGCCCATCGATGAAGAAGACCCCGAGGCCAAGCAGGCTGCCCTA
TCCAGCGTCGCCAACACGCTCAAGGCCGGGACGGCGACCCGCCGCTCCAGCACCTTCCGGGGACGCCGCGATATC
CGCAACACCATCTACCTCCCGACCCCTACATCGAGCATACGCGAGAGCCAATCCGACGGAGCGATGCCGTCCATC
ACGGGCTCACCCCCCCTGACGTCTTCTTCCTTCTCCCGCCCGACGCCCGTGGCGGCACTGGCGTCGGAAACCAGC
GTCGCCGGCACGTCCGACTCGCAGTCGGTGCGGTCCGGCAACTCGCTGGGCAGCATGGGTCATGTCAGGCATCCC
GACATGACCGGCCCGGGCCTTCACGGCTCCGTCATCGAGACCGTCTCTGCCGTGTTTGAGGACGGAGAGGTCAAG
AGCGCAGCCATCACGGGCGAGATTGCCTTTGTGAATAACGTTTCTCAGGCAGGCGGAAAGACACACGAGACAATA
CGGATCAAGACGGTCCCGAGACTCGAGCGCCTCGGCCCCAACCGCATCTTCGTCCAGAACTCATCGGCAGAGCAG
CCGCAACAGTTTGTGCTCGACGTCTCTCCCCTGGCAAGGACGATGACGGCCTTCTCGTACCGCGTCTGCTCCGGC
GAGTCTGATTCCCCTGACCTCGGCTCGCGCGTGCCGCTGCTGCTGAAGCCGGCGTGGAAGCCACAGGGCGAGAAG
CTGGGACTCCTTCTGCAGTACCAACTCAACCCATCGGCGCAGCTGTCGGGCTCCCTGACGCTCCACAATGTCGTC
TTCGTCGTCACGTACGAGGGGAACGCGACGACGGCGCAGACGAAGCCCGGCGGGACGCACCTGCGGGACAAGCAT
CTGGTCTACTGCCGCCTGGGCGACGTGACGCTTACGAGCAGCGTGCAGAAGATGGTGTGTCTCATCGTCGGGGCC
GACGGCGTAGCCCCGACGCCCGGCCACGTCGAGGCCCGATGGGAGTGTGTCACTGCTGGAACCGATGCCGTGGGG
AGCGGCATCTCAATCTCGAGGCTGGAGGAGGATGGCGAGAAGAGCGCGGCGGCGACCGAGGACGATCCATTCGCT
GATCATGGCCTTGCCGCGGGCCAGAGCTGGGTGGACGTGCCGCTACAGAGGAGGCTCATCAGCGGCAAGTACGAG
GGCAAATGA
Gene >Ophio5|1721
ATGGACGACCTTGCCAGGGCCGAGTATCCCGGCCTTCTGGTGAGTCTCGTTCAGCGATATTCGTGCCCGACCGTC
GGCCCAGACTGACCACGGGCGCTCCTCAGGCCACCATGATGCCCGGCCAAGCTGTCTTGACCCTCAGCGAACGGA
TCAAGCGCATCAACAGAATCAATCTCGAGATTGCCGACTGGCTTCAGGTAGCCTATTATTATCCACCGCCCCTTC
TCGCACCAGATGCCTGACTTTGGCCCACAGGAGCGTCGTCGCGTCGAGGAGCAGTATGCCCTCGGCCTGCGCAGG
CTCGCCCAGCATAGAGTCCCCAACTCTAACTCGGAATTAGGGTGCGCTCGCCCGCGTCGCCCGCTCTGATTCGAC
TTCGCTGACCCAACTCTAGAGTCTTTCACGCCCCTTGGATGCGAATCCTCGAGTCGGTCGATCGCATCGCAAAGT
CGCACCACCTGTTCGCCGAGCGCATCGAAAAGGATGTCGAATACCCCTTGCGAGCCTACCAGCAGCGCCGCGACT
ATCAAAATATGCACAACATCTCCTCCAACCTCGCCGTCTTGGCCAGGGACCTCGACGATGCCCAGGACAAGGCGG
AAAAGCTTAACAGGAGGGGCGGCAAGGCCAACTCTCAAAAAGTCGAAGCCGCCACCACCAGGCTCGAGTCGGCCG
CTCAGCAGTGGGAGTCCCAGGCCCCGTTCGTCTTCGAGACGCTGCAGGTCGTCGACGAGTCGCGCGTCAACCAGC
TCCGTGACCTCCTGACGCAGTATCAGACGCAGGAGGCCTCCCAGGCCCAGCGCGCTCAGGACAATGCCGTCGAAG
CCTTGGCTGCCATGCTCGAGATAAGCACTGACAAGGAAATCAAAGACTTTGCAAGACGAGCGGCCGAAAACAAGC
TGCCGCTGCCTTCGCAACCGATGCACTCGTCACACCCCAACCCTGTTCGCTCCGTCACGAGACGCTTGTCCATGG
CTGCAGCGCCTCTTCACCGGCCACTCACCGCGTCTGCGCCGCCGCCGCCACCACCACCACCGCCTCCAGTCGTCG
CACCGGCTGGACATCCGACCGGAGCGCCGGCTGCCGCACCGACCGCCGCGACGGCTGGCTCGACGACCGGCGCAG
CCTCGTTGGGACCTCCGCCGGCGGGCGCCAACCCCCCTCCGCCTCCCGCCGAGGACGGCGTTAGCGACCACGATT
CCTTCCCAGCTGACGCCAAGCCAGGTAAGCAGTCCTTCGCCGACGTCTTGTGGCCTGTAGCGCTGACCGTCTCGC
AGAATCCAAACTGCGACGCCTCGGGACCATGTTCGGGAACCGACGGCGGCAGAGCGTCTACGGGGGTGGTTCCGG
CCCCATCACGCCTCAGAGGACGGGCCCAGCCGCCTTTGGGCGCTCGACCACCTCCCACAGCCGAGGCGTCTCTCC
GAGGCCGTCGATGAGCAATCTTCACCAGGACCACGGCCGACTGTCCGCCCTCGACGAGATGCCAAACCGGCTCGA
ACATGACGCGCCAGCCACAGACGACAGCGGGCCTCCCCACGCGGGAACAAACGGGGTGTCGGCCGGTGGTGAAAA
TCCGCCGCACCTCTCCGCGACCGGCGCCGCTGCCGACCTCGTTGGCATGAACGGGACCCACGACGTGGATGTGGC
GGCCGTACCTCCACCGCCCGGCCCGCCTCCGGGACAGCAGGCGGCTGAAGGGGGGCCTTTGTCGCCGGCCCAGGA
CCTCGAGGGCTACACCGTGCGGGCGCCCATGAACGATCCCATCTCCGAGGCTCAGCGGGAGGCTGCTGGCGAGGA
TGCCGATCAGCTCCTCAAACTCAACATCCAGAACAAGCCCATCGATGAAGAAGACCCCGAGGCCAAGCAGGCTGC
CCTATCCAGCGTCGCCAACACGCTCAAGGCCGGGACGGCGACCCGCCGCTCCAGCACCTTCCGGGGACGCCGCGA
TATCCGCAACACCATCTACCTCCCGACCCCTACATCGAGCATACGCGAGAGCCAATCCGACGGAGCGATGCCGTC
CATCACGGGCTCACCCCCCCTGACGTCTTCTTCCTTCTCCCGCCCGACGCCCGTGGCGGCACTGGCGTCGGAAAC
CAGCGTCGCCGGCACGTCCGACTCGCAGTCGGTGCGGTCCGGCAACTCGCTGGGCAGCATGGGTCATGTCAGGCA
TCCCGACATGACCGGCCCGGGCCTTCACGGCTCCGTCATCGAGACCGTCTCTGCCGTGTTTGAGGACGGAGAGGT
CAAGAGCGCAGCCATCACGGGCGAGATTGCCTTTGTGAATAACGTTTCTCAGGCAGGCGGAAAGAGTATGTTCTC
TGTTCCTCTTCACGAGCTGCCAAGGCTAACAGGGCGAGAAGCACACGAGACAATACGGATCAAGACGGTCCCGAG
ACTCGAGCGCCTCGGCCCCAACCGCATCTTCGTCCAGAACTCATCGGCAGAGCAGCCGCAACAGTTTGTGCTCGA
CGTCTCTCCCCTGGCAAGGACGATGACGGCCTTCTCGTACCGCGTCTGCTCCGGCGAGTCTGATTCCCCTGACCT
CGGCTCGCGCGTGCCGCTGCTGCTGAAGCCGGCGTGGAAGCCACAGGGCGAGAAGCTGGGACTCCTTCTGCAGTA
CCAACTCAACCCATCGGCGCAGCTGTCGGGCTCCCTGACGCTCCACAATGTCGTCTTCGTCGTCACGTACGAGGG
GAACGCGACGACGGCGCAGACGAAGCCCGGCGGGACGCACCTGCGGGACAAGCATCTGGTCTACTGCCGCCTGGG
CGACGTGACGCTTACGAGCAGCGTGCAGAAGATGGTGTGTCTCATCGTCGGGGCCGACGGCGTAGCCCCGACGCC
CGGCCACGTCGAGGCCCGATGGGAGTGTGTCACTGCTGGAACCGATGCCGTGGGGAGCGGCATCTCAATCTCGAG
GCTGGAGGAGGATGGCGAGAAGAGCGCGGCGGCGACCGAGGACGATCCATTCGCTGATCATGGCCTTGCCGCGGG
CCAGAGCTGGGTGGACGTGCCGCTACAGAGGAGGCTCATCAGCGGCAAGTACGAGGGCAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail