Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1720
Gene name
Locationscaffold_164:9515..11636
Strand+
Gene length (bp)2121
Transcript length (bp)1803
Coding sequence length (bp)1800
Protein length (aa) 600

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09139 Tam41_Mmp37 Phosphatidate cytidylyltransferase, mitochondrial 4.4E-120 223 589

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53230|TAM41_YEAST Phosphatidate cytidylyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAM41 PE=1 SV=1 203 452 4.0E-57
sp|O74339|TAM41_SCHPO Phosphatidate cytidylyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tam41 PE=1 SV=3 209 593 2.0E-56
sp|Q6DJM2|TAM41_XENLA Phosphatidate cytidylyltransferase, mitochondrial OS=Xenopus laevis GN=tamm41 PE=2 SV=1 222 589 2.0E-51
sp|Q3TUH1|TAM41_MOUSE Phosphatidate cytidylyltransferase, mitochondrial OS=Mus musculus GN=Tamm41 PE=1 SV=2 221 592 4.0E-49
sp|Q32L81|TAM41_BOVIN Phosphatidate cytidylyltransferase, mitochondrial OS=Bos taurus GN=TAMM41 PE=2 SV=1 221 465 2.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53230|TAM41_YEAST Phosphatidate cytidylyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAM41 PE=1 SV=1 203 452 4.0E-57
sp|O74339|TAM41_SCHPO Phosphatidate cytidylyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tam41 PE=1 SV=3 209 593 2.0E-56
sp|Q6DJM2|TAM41_XENLA Phosphatidate cytidylyltransferase, mitochondrial OS=Xenopus laevis GN=tamm41 PE=2 SV=1 222 589 2.0E-51
sp|Q3TUH1|TAM41_MOUSE Phosphatidate cytidylyltransferase, mitochondrial OS=Mus musculus GN=Tamm41 PE=1 SV=2 221 592 4.0E-49
sp|Q32L81|TAM41_BOVIN Phosphatidate cytidylyltransferase, mitochondrial OS=Bos taurus GN=TAMM41 PE=2 SV=1 221 465 2.0E-48
sp|Q96BW9|TAM41_HUMAN Phosphatidate cytidylyltransferase, mitochondrial OS=Homo sapiens GN=TAMM41 PE=1 SV=2 221 465 2.0E-46
sp|Q3B7H2|TAM41_DANRE Phosphatidate cytidylyltransferase, mitochondrial OS=Danio rerio GN=tamm41 PE=2 SV=1 223 457 2.0E-45
sp|Q550P4|TAM41_DICDI Phosphatidate cytidylyltransferase, mitochondrial OS=Dictyostelium discoideum GN=DDB_G0277049 PE=3 SV=1 217 583 2.0E-43
sp|Q8INF2|TAM41_DROME Phosphatidate cytidylyltransferase, mitochondrial OS=Drosophila melanogaster GN=CG33331 PE=2 SV=1 233 447 2.0E-38
sp|Q9N4G7|TAM41_CAEEL Phosphatidate cytidylyltransferase, mitochondrial OS=Caenorhabditis elegans GN=Y71F9B.2 PE=3 SV=2 233 502 8.0E-26
sp|Q61X59|TAM41_CAEBR Phosphatidate cytidylyltransferase, mitochondrial OS=Caenorhabditis briggsae GN=CBG04116 PE=3 SV=1 233 449 3.0E-24
[Show less]

GO

GO Term Description Terminal node
GO:0004605 phosphatidate cytidylyltransferase activity Yes
GO:0032049 cardiolipin biosynthetic process Yes
GO:0046474 glycerophospholipid biosynthetic process No
GO:0044255 cellular lipid metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0008654 phospholipid biosynthetic process No
GO:0006644 phospholipid metabolic process No
GO:0044238 primary metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0032048 cardiolipin metabolic process No
GO:0008150 biological_process No
GO:0070567 cytidylyltransferase activity No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0046486 glycerolipid metabolic process No
GO:0009987 cellular process No
GO:0046471 phosphatidylglycerol metabolic process No
GO:0006655 phosphatidylglycerol biosynthetic process No
GO:0006629 lipid metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0045017 glycerolipid biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0016779 nucleotidyltransferase activity No
GO:0009058 biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2075 0.1191 0.0747 0.1117 0.8794 0.1506 0.1529 0.0658 0.1821 0.0279

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3399
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2712
Ophiocordyceps australis map64 (Brazil) OphauB2|5627
Ophiocordyceps camponoti-floridani Ophcf2|06280
Ophiocordyceps camponoti-rufipedis Ophun1|4972
Ophiocordyceps kimflemingae Ophio5|1720 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6362

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1720
MSRDIGPSRNAVQTKLKHPKPALTDLTWEPTQEPRGRTGEMPAPKKGPPRARESNSAGSDSIPFLLPATTLVHHA
STASPRPLLAHVCRSRAVMAVVRLPVAAASFMASAVTRRSVETVACAARQRRPMPLFRYSSSSSSSSSSSSSPSS
SPSSSSSASSSSSPSSTPSSSSSHAPATSDSLYDGTWEDSVDFAIGTFDELPHRLFGINQHMIINHELKEALRLM
LRQFNAPIVYCFAYGSGVFPQQASSDNQQHQPFRNIHSRPPEALARAQGSSPRMIDFIFGVSHTQHWHSVNMRQH
RNHYSAVASLGSSFVSRVQRWGAGVYFNPYVDINGMLIKYGVTSIDNLVDDLSTWHNLYLAGRLQKPVKILRDHP
RVRLANQHNLIAALRTALLLLPAEFDEAQLYGTIAGLSYLGDPRMALPTEDRSKIANMVSHNVVHFRRLYAPLVR
TLPNVTYLQGPVRFDDENWLLDTGADTRLRQDMDPARRANMVRRLPNRFRSRLYLRYRRELGVAVDEAADDDAQA
PTDSFQGGPFDRRIASDDARRLHRVVRQVIRQTVNWPSTTQSVKGLLMGGWRRSWRYLGDKFAKWRAGGGKGAKT
Coding >Ophio5|1720
ATGTCACGTGACATCGGGCCGAGCCGCAACGCCGTCCAAACCAAACTCAAACACCCGAAGCCTGCCCTCACTGAC
CTGACCTGGGAGCCTACCCAGGAGCCGCGAGGCCGGACCGGAGAGATGCCGGCACCGAAAAAGGGCCCGCCACGT
GCGAGAGAGTCCAATTCTGCCGGAAGCGATTCTATTCCTTTCCTTTTACCGGCAACAACTCTCGTTCATCACGCT
TCAACCGCTTCGCCTCGTCCTTTGCTTGCGCATGTCTGCCGCTCGCGTGCCGTCATGGCCGTCGTTCGCTTGCCG
GTTGCCGCGGCTTCGTTTATGGCCTCGGCCGTGACGCGTCGCTCCGTTGAGACCGTCGCCTGCGCGGCTCGGCAA
CGGCGGCCGATGCCTCTCTTTCGATATTCATCGTCGTCGTCGTCTTCGTCATCTTCGTCGTCCTCTCCGTCGTCC
TCTCCTTCGTCCTCTTCTTCCGCGTCTTCATCCTCGTCCCCTTCTTCCACCCCCTCGTCATCTTCCTCACACGCC
CCAGCCACCTCTGACAGCCTCTACGACGGCACCTGGGAAGACTCGGTCGACTTCGCCATCGGCACCTTCGACGAG
CTCCCCCACCGCCTCTTCGGCATCAACCAGCACATGATCATCAACCACGAGCTCAAAGAAGCCCTCCGGCTGATG
CTCCGCCAGTTCAACGCGCCCATCGTCTACTGCTTTGCCTACGGCTCCGGCGTCTTCCCCCAGCAAGCCTCGTCC
GATAATCAACAGCATCAACCTTTCCGCAACATCCATTCCCGCCCGCCAGAGGCCCTCGCCCGCGCTCAGGGCTCC
TCCCCGCGCATGATCGACTTCATCTTCGGCGTCAGCCATACCCAACACTGGCACTCCGTCAACATGCGCCAGCAT
CGCAATCATTACTCTGCCGTCGCTTCCCTCGGCTCCAGCTTCGTCTCGCGCGTCCAGCGATGGGGAGCCGGCGTC
TACTTTAATCCGTACGTCGATATCAACGGCATGCTAATCAAGTACGGCGTCACCAGCATCGATAATCTCGTCGAC
GACCTTTCCACTTGGCATAACCTCTACCTTGCGGGCCGTCTGCAGAAACCCGTCAAGATCCTCCGCGATCATCCG
CGCGTCCGTCTCGCCAACCAGCATAACCTCATCGCCGCTCTTCGCACCGCCCTCCTCCTCCTACCCGCCGAGTTC
GACGAAGCGCAGCTGTACGGTACCATCGCGGGCCTCAGCTACCTGGGCGACCCTCGCATGGCCCTACCGACCGAG
GACCGGTCCAAGATCGCAAACATGGTCAGTCACAACGTCGTCCACTTCCGTCGTCTGTACGCGCCTCTCGTCCGC
ACCCTCCCCAACGTCACCTACCTACAAGGCCCCGTCCGCTTCGACGACGAGAACTGGCTCCTCGATACCGGTGCC
GATACCCGTCTGCGTCAGGACATGGACCCGGCTCGTCGCGCCAACATGGTTCGTCGCCTGCCCAATCGCTTCCGC
TCGCGGCTCTACCTCCGCTACAGAAGAGAGCTCGGCGTCGCGGTGGACGAGGCTGCCGACGACGACGCTCAGGCT
CCTACCGATAGCTTCCAGGGCGGGCCCTTTGACCGCCGTATCGCCTCGGATGATGCTCGTCGTCTCCATCGCGTC
GTCCGCCAGGTCATCAGGCAGACGGTCAACTGGCCCAGCACCACCCAGAGCGTCAAGGGCCTATTGATGGGCGGC
TGGCGACGCTCCTGGCGCTATCTAGGAGACAAGTTTGCCAAGTGGCGCGCCGGAGGGGGCAAGGGAGCGAAGACT
Transcript >Ophio5|1720
ATGTCACGTGACATCGGGCCGAGCCGCAACGCCGTCCAAACCAAACTCAAACACCCGAAGCCTGCCCTCACTGAC
CTGACCTGGGAGCCTACCCAGGAGCCGCGAGGCCGGACCGGAGAGATGCCGGCACCGAAAAAGGGCCCGCCACGT
GCGAGAGAGTCCAATTCTGCCGGAAGCGATTCTATTCCTTTCCTTTTACCGGCAACAACTCTCGTTCATCACGCT
TCAACCGCTTCGCCTCGTCCTTTGCTTGCGCATGTCTGCCGCTCGCGTGCCGTCATGGCCGTCGTTCGCTTGCCG
GTTGCCGCGGCTTCGTTTATGGCCTCGGCCGTGACGCGTCGCTCCGTTGAGACCGTCGCCTGCGCGGCTCGGCAA
CGGCGGCCGATGCCTCTCTTTCGATATTCATCGTCGTCGTCGTCTTCGTCATCTTCGTCGTCCTCTCCGTCGTCC
TCTCCTTCGTCCTCTTCTTCCGCGTCTTCATCCTCGTCCCCTTCTTCCACCCCCTCGTCATCTTCCTCACACGCC
CCAGCCACCTCTGACAGCCTCTACGACGGCACCTGGGAAGACTCGGTCGACTTCGCCATCGGCACCTTCGACGAG
CTCCCCCACCGCCTCTTCGGCATCAACCAGCACATGATCATCAACCACGAGCTCAAAGAAGCCCTCCGGCTGATG
CTCCGCCAGTTCAACGCGCCCATCGTCTACTGCTTTGCCTACGGCTCCGGCGTCTTCCCCCAGCAAGCCTCGTCC
GATAATCAACAGCATCAACCTTTCCGCAACATCCATTCCCGCCCGCCAGAGGCCCTCGCCCGCGCTCAGGGCTCC
TCCCCGCGCATGATCGACTTCATCTTCGGCGTCAGCCATACCCAACACTGGCACTCCGTCAACATGCGCCAGCAT
CGCAATCATTACTCTGCCGTCGCTTCCCTCGGCTCCAGCTTCGTCTCGCGCGTCCAGCGATGGGGAGCCGGCGTC
TACTTTAATCCGTACGTCGATATCAACGGCATGCTAATCAAGTACGGCGTCACCAGCATCGATAATCTCGTCGAC
GACCTTTCCACTTGGCATAACCTCTACCTTGCGGGCCGTCTGCAGAAACCCGTCAAGATCCTCCGCGATCATCCG
CGCGTCCGTCTCGCCAACCAGCATAACCTCATCGCCGCTCTTCGCACCGCCCTCCTCCTCCTACCCGCCGAGTTC
GACGAAGCGCAGCTGTACGGTACCATCGCGGGCCTCAGCTACCTGGGCGACCCTCGCATGGCCCTACCGACCGAG
GACCGGTCCAAGATCGCAAACATGGTCAGTCACAACGTCGTCCACTTCCGTCGTCTGTACGCGCCTCTCGTCCGC
ACCCTCCCCAACGTCACCTACCTACAAGGCCCCGTCCGCTTCGACGACGAGAACTGGCTCCTCGATACCGGTGCC
GATACCCGTCTGCGTCAGGACATGGACCCGGCTCGTCGCGCCAACATGGTTCGTCGCCTGCCCAATCGCTTCCGC
TCGCGGCTCTACCTCCGCTACAGAAGAGAGCTCGGCGTCGCGGTGGACGAGGCTGCCGACGACGACGCTCAGGCT
CCTACCGATAGCTTCCAGGGCGGGCCCTTTGACCGCCGTATCGCCTCGGATGATGCTCGTCGTCTCCATCGCGTC
GTCCGCCAGGTCATCAGGCAGACGGTCAACTGGCCCAGCACCACCCAGAGCGTCAAGGGCCTATTGATGGGCGGC
TGGCGACGCTCCTGGCGCTATCTAGGAGACAAGTTTGCCAAGTGGCGCGCCGGAGGGGGCAAGGGAGCGAAGACT
TAG
Gene >Ophio5|1720
ATGTCACGTGACATCGGGCCGAGCCGCAACGCCGTCCAAACCAAACTCAAACAGTAGGTAGCAGTCAGCGTGCCA
TCAACTACTACTACCGTCTAGTAGTAGCAGTAGCAGTGGGTAGCTGCTGATGGCTCACGGGGAGCCTTTTTGTTT
GCTTATAGCCTATAGCCCGAAGCCTGCCCTCACTGACCTGACCTGGGAGCCTACCCAGGAGCCGCGAGGCCGGAC
CGGAGAGATGCCGGCACCGAAAAAGGGCCCGCCACGTGCGAGAGAGTCCAATTCTGCCGGAAGCGATTCTATTCC
TTTCCTTTTACCGGCAACAACTGTTGGTTCTTTTTCCATCATTTTCTCTTCTCTAGACTCATCTACTCATCTATT
CATAGCTCGTTGTCAGCTTCTGAACCCTCCTCCCTCGTCACGTCAAACGCTTCCTCTCCTTGAACCGGCCTAGCA
TCACGCTTCAACCGCTTCGCCTCGTCCTTTGCTTGCGCATGTCTGCCGCTCGCGTGCCGTCATGGCCGTCGTTCG
CTTGCCGGTGAGGAACTCTTTTCCTTTTTATTTTATATTTTTATTTTTTTCTGCCCTCTCAAGCTCTTCTGCTGA
CGTGGGCGCCAAAAACAGGTTGCCGCGGCTTCGTTTATGGCCTCGGCCGTGACGCGTCGCTCCGTTGAGACCGTC
GCCTGCGCGGCTCGGCAACGGCGGCCGATGCCTCTCTTTCGATATTCATCGTCGTCGTCGTCTTCGTCATCTTCG
TCGTCCTCTCCGTCGTCCTCTCCTTCGTCCTCTTCTTCCGCGTCTTCATCCTCGTCCCCTTCTTCCACCCCCTCG
TCATCTTCCTCACACGCCCCAGCCACCTCTGACAGCCTCTACGACGGCACCTGGGAAGACTCGGTCGACTTCGCC
ATCGGCACCTTCGACGAGCTCCCCCACCGCCTCTTCGGCATCAACCAGCACATGATCATCAACCACGAGCTCAAA
GAAGCCCTCCGGCTGATGCTCCGCCAGTTCAACGCGCCCATCGTCTACTGCTTTGCCTACGGCTCCGGCGTCTTC
CCCCAGCAAGCCTCGTCCGATAATCAACAGCATCAACCTTTCCGCAACATCCATTCCCGCCCGCCAGAGGCCCTC
GCCCGCGCTCAGGGCTCCTCCCCGCGCATGATCGACTTCATCTTCGGCGTCAGCCATACCCAACACTGGCACTCC
GTCAACATGCGCCAGCATCGCAATCATTACTCTGCCGTCGCTTCCCTCGGCTCCAGCTTCGTCTCGCGCGTCCAG
CGATGGGGAGCCGGCGTCTACTTTAATCCGTACGTCGATATCAACGGCATGCTAATCAAGTACGGCGTCACCAGC
ATCGATAATCTCGTCGACGACCTTTCCACTTGGCATAACCTCTACCTTGCGGGCCGTCTGCAGAAACCCGTCAAG
ATCCTCCGCGATCATCCGCGCGTCCGTCTCGCCAACCAGCATAACCTCATCGCCGCTCTTCGCACCGCCCTCCTC
CTCCTACCCGCCGAGTTCGACGAAGCGCAGCTGTACGGTACCATCGCGGGCCTCAGCTACCTGGGCGACCCTCGC
ATGGCCCTACCGACCGAGGACCGGTCCAAGATCGCAAACATGGTCAGTCACAACGTCGTCCACTTCCGTCGTCTG
TACGCGCCTCTCGTCCGCACCCTCCCCAACGTCACCTACCTACAAGGCCCCGTCCGCTTCGACGACGAGAACTGG
CTCCTCGATACCGGTGCCGATACCCGTCTGCGTCAGGACATGGACCCGGCTCGTCGCGCCAACATGGTTCGTCGC
CTGCCCAATCGCTTCCGCTCGCGGCTCTACCTCCGCTACAGAAGAGAGCTCGGCGTCGCGGTGGACGAGGCTGCC
GACGACGACGCTCAGGCTCCTACCGATAGCTTCCAGGGCGGGCCCTTTGACCGCCGTATCGCCTCGGATGATGCT
CGTCGTCTCCATCGCGTCGTCCGCCAGGTCATCAGGCAGACGGTCAACTGGCCCAGCACCACCCAGAGCGTCAAG
GGCCTATTGATGGGCGGCTGGCGACGCTCCTGGCGCTATCTAGGAGACAAGTTTGCCAAGTGGCGCGCCGGAGGG
GGCAAGGGAGCGAAGACTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail