Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|172
Gene name
Locationscaffold_1021:71..1308
Strand+
Gene length (bp)1237
Transcript length (bp)1062
Coding sequence length (bp)1059
Protein length (aa) 353

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05719 GPP34 Golgi phosphoprotein 3 (GPP34) 1.1E-68 79 303

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14205|VPS74_SCHPO Vacuolar protein sorting-associated protein 74 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps74 PE=1 SV=2 4 353 3.0E-152
sp|P62583|VPS74_ASHGO Vacuolar protein sorting-associated protein 74 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VPS74 PE=3 SV=1 55 353 4.0E-124
sp|Q06385|VPS74_YEAST Vacuolar protein sorting-associated protein 74 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS74 PE=1 SV=1 5 353 2.0E-122
sp|Q5PPU5|GP3LA_XENLA Golgi phosphoprotein 3-like A OS=Xenopus laevis GN=golph3l-a PE=2 SV=1 62 297 3.0E-64
sp|Q5U4Q6|GLP3L_XENTR Golgi phosphoprotein 3-like OS=Xenopus tropicalis GN=golph3l PE=2 SV=1 62 297 1.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14205|VPS74_SCHPO Vacuolar protein sorting-associated protein 74 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps74 PE=1 SV=2 4 353 3.0E-152
sp|P62583|VPS74_ASHGO Vacuolar protein sorting-associated protein 74 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VPS74 PE=3 SV=1 55 353 4.0E-124
sp|Q06385|VPS74_YEAST Vacuolar protein sorting-associated protein 74 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS74 PE=1 SV=1 5 353 2.0E-122
sp|Q5PPU5|GP3LA_XENLA Golgi phosphoprotein 3-like A OS=Xenopus laevis GN=golph3l-a PE=2 SV=1 62 297 3.0E-64
sp|Q5U4Q6|GLP3L_XENTR Golgi phosphoprotein 3-like OS=Xenopus tropicalis GN=golph3l PE=2 SV=1 62 297 1.0E-63
sp|Q9VQ93|GOLP3_DROME Golgi phosphoprotein 3 homolog sauron OS=Drosophila melanogaster GN=sau PE=1 SV=1 1 297 2.0E-63
sp|A0JPI4|GP3LB_XENLA Golgi phosphoprotein 3-like B OS=Xenopus laevis GN=golph3l-b PE=2 SV=1 62 297 3.0E-63
sp|Q8R088|GLP3L_MOUSE Golgi phosphoprotein 3-like OS=Mus musculus GN=Golph3l PE=1 SV=1 41 297 5.0E-62
sp|A6H7F6|GLP3L_BOVIN Golgi phosphoprotein 3-like OS=Bos taurus GN=GOLPH3L PE=2 SV=1 40 297 5.0E-62
sp|Q66H74|GLP3L_RAT Golgi phosphoprotein 3-like OS=Rattus norvegicus GN=Golph3l PE=2 SV=1 41 297 6.0E-62
sp|Q9H4A5|GLP3L_HUMAN Golgi phosphoprotein 3-like OS=Homo sapiens GN=GOLPH3L PE=1 SV=1 27 297 3.0E-61
sp|Q9ERE4|GOLP3_RAT Golgi phosphoprotein 3 OS=Rattus norvegicus GN=Golph3 PE=1 SV=1 71 297 5.0E-61
sp|Q9CRA5|GOLP3_MOUSE Golgi phosphoprotein 3 OS=Mus musculus GN=Golph3 PE=1 SV=1 71 297 5.0E-61
sp|Q9H4A6|GOLP3_HUMAN Golgi phosphoprotein 3 OS=Homo sapiens GN=GOLPH3 PE=1 SV=1 71 297 7.0E-61
sp|Q54J20|VP74L_DICDI VPS74-like protein DDB_G0288371 OS=Dictyostelium discoideum GN=DDB_G0288371 PE=3 SV=1 74 238 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0070273 phosphatidylinositol-4-phosphate binding Yes
GO:1901981 phosphatidylinositol phosphate binding No
GO:0005488 binding No
GO:0005543 phospholipid binding No
GO:0003674 molecular_function No
GO:0008289 lipid binding No
GO:0035091 phosphatidylinositol binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.6152 0.3766 0.0211 0.1717 0.2228 0.0033 0.1836 0.3564 0.52 0.1521

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2440
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1161
Ophiocordyceps australis map64 (Brazil) OphauB2|2622
Ophiocordyceps camponoti-floridani Ophcf2|03210
Ophiocordyceps camponoti-rufipedis Ophun1|4924
Ophiocordyceps kimflemingae Ophio5|172 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3470

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|172
MSSSSGLTRRRGAGAGTGLNTADGETSNAASRTNSATNVRDSAPETSYEKSENGHKIAFDPRDISESAERSKQPK
LTMMEEVLLLGLKDKQGYLSFWNDNISYALRGCIVLELALRGRISMEKDPARRRFPPADRNIEVIDDTLTGEVLL
DEALKMMKQSEKMSVSSWIDLMSGETWNLMKIGYQLKQVRERLAKGLVDKGILRTEKRNFLLFDMATHPVADGGA
KEEIRRRVRNVLTQRTVVLNNSQFLPESLDFRYLRTVSMVCAAYAANVLENALSTLGHEARERAFAQTDELLADY
SQWPFGKKAVGNGIGANLPQVIAEEISRAKDKELQLEVVAACLSVFTRLDSLL
Coding >Ophio5|172
ATGTCGTCGTCGTCGGGGCTGACACGCCGCCGTGGCGCCGGCGCCGGCACCGGCCTCAACACAGCCGACGGTGAG
ACCAGTAACGCCGCCTCAAGGACCAACTCGGCCACCAACGTGCGCGACAGCGCCCCCGAGACGAGCTACGAGAAG
AGCGAGAATGGTCACAAGATCGCTTTCGACCCCCGCGACATCAGCGAGAGCGCCGAGCGCAGCAAACAACCCAAG
CTCACCATGATGGAGGAGGTGCTGCTTCTCGGCCTCAAAGACAAGCAGGGATATCTCTCCTTTTGGAACGACAAC
ATCTCATACGCCCTCCGCGGCTGTATCGTCCTCGAGCTGGCCCTCCGTGGCCGCATCAGCATGGAAAAGGACCCG
GCCAGAAGGCGCTTTCCCCCAGCCGACCGCAACATCGAGGTCATAGACGATACCCTCACCGGCGAGGTGCTACTC
GACGAGGCTCTCAAGATGATGAAACAGAGCGAAAAGATGAGCGTCAGTTCCTGGATCGACCTGATGAGCGGCGAG
ACGTGGAACCTGATGAAGATTGGCTATCAGCTCAAGCAGGTCCGCGAGCGACTCGCCAAGGGCCTCGTCGATAAG
GGCATCCTGCGAACCGAAAAGCGCAACTTCCTCCTCTTCGACATGGCCACCCATCCCGTGGCCGACGGCGGCGCA
AAGGAAGAAATTCGTCGCCGCGTGCGGAACGTCCTGACGCAGCGCACCGTCGTCCTCAACAACAGTCAATTCCTG
CCCGAGTCTCTCGACTTCCGCTACCTGCGCACCGTGTCCATGGTCTGCGCCGCCTACGCCGCCAACGTGCTGGAG
AATGCGCTTTCGACGCTCGGCCACGAAGCCCGCGAGCGCGCCTTTGCCCAGACGGACGAGCTGCTGGCCGACTAC
AGCCAGTGGCCCTTTGGCAAGAAGGCTGTCGGCAATGGCATCGGTGCCAATTTGCCCCAGGTCATCGCAGAGGAG
ATTAGCCGCGCAAAGGACAAGGAGCTGCAGCTCGAGGTCGTCGCCGCTTGTCTCAGCGTCTTTACCCGTCTGGAC
TCCTTGCTA
Transcript >Ophio5|172
ATGTCGTCGTCGTCGGGGCTGACACGCCGCCGTGGCGCCGGCGCCGGCACCGGCCTCAACACAGCCGACGGTGAG
ACCAGTAACGCCGCCTCAAGGACCAACTCGGCCACCAACGTGCGCGACAGCGCCCCCGAGACGAGCTACGAGAAG
AGCGAGAATGGTCACAAGATCGCTTTCGACCCCCGCGACATCAGCGAGAGCGCCGAGCGCAGCAAACAACCCAAG
CTCACCATGATGGAGGAGGTGCTGCTTCTCGGCCTCAAAGACAAGCAGGGATATCTCTCCTTTTGGAACGACAAC
ATCTCATACGCCCTCCGCGGCTGTATCGTCCTCGAGCTGGCCCTCCGTGGCCGCATCAGCATGGAAAAGGACCCG
GCCAGAAGGCGCTTTCCCCCAGCCGACCGCAACATCGAGGTCATAGACGATACCCTCACCGGCGAGGTGCTACTC
GACGAGGCTCTCAAGATGATGAAACAGAGCGAAAAGATGAGCGTCAGTTCCTGGATCGACCTGATGAGCGGCGAG
ACGTGGAACCTGATGAAGATTGGCTATCAGCTCAAGCAGGTCCGCGAGCGACTCGCCAAGGGCCTCGTCGATAAG
GGCATCCTGCGAACCGAAAAGCGCAACTTCCTCCTCTTCGACATGGCCACCCATCCCGTGGCCGACGGCGGCGCA
AAGGAAGAAATTCGTCGCCGCGTGCGGAACGTCCTGACGCAGCGCACCGTCGTCCTCAACAACAGTCAATTCCTG
CCCGAGTCTCTCGACTTCCGCTACCTGCGCACCGTGTCCATGGTCTGCGCCGCCTACGCCGCCAACGTGCTGGAG
AATGCGCTTTCGACGCTCGGCCACGAAGCCCGCGAGCGCGCCTTTGCCCAGACGGACGAGCTGCTGGCCGACTAC
AGCCAGTGGCCCTTTGGCAAGAAGGCTGTCGGCAATGGCATCGGTGCCAATTTGCCCCAGGTCATCGCAGAGGAG
ATTAGCCGCGCAAAGGACAAGGAGCTGCAGCTCGAGGTCGTCGCCGCTTGTCTCAGCGTCTTTACCCGTCTGGAC
TCCTTGCTATGA
Gene >Ophio5|172
ATGTCGTCGTCGTCGGGGCTGACACGCCGCCGTGGCGCCGGCGCCGGCACCGGCCTCAACACAGCCGACGGTGAG
ACCAGTAACGCCGCCTCAAGGACCAACTCGGCCACCAACGTGCGCGACAGCGCCCCCGAGACGAGCTACGAGAAG
AGCGAGAATGGTCACAAGATCGCTTTCGACCCCCGCGACATCAGCGAGAGCGCCGAGCGCAGCAAACAACCCAAG
CTCACCATGATGGAGGAGGTGCTGCTTCTCGGCCTCAAAGACAAGCAGGTTCGTTCCCGTTCTTCACACACTCAC
ACACGCACACTCACGTCCAACCCGCCCGCAGGGATATCTCTCCTTTTGGAACGACAACATCTCATACGCCCTCCG
CGGCTGTATCGTCCTCGAGCTGGCCCTCCGTGGCCGCATCAGCATGGAAAAGGACCCGGCCAGAAGGCGCTTTCC
CCCAGCCGACCGCAACATCGAGGTCATAGACGATACCCTCACCGGCGAGGTGCTACTCGACGAGGCTCTCAAGAT
GATGAAACAGAGCGAAAAGATGAGCGTCAGTTCCTGGATCGACCTGATGAGCGGTTCGTTTTCTCTTTCCCTTAA
CACAACCCGCCGACTGACAGCCGTCAAATCCAGGCGAGACGTGGAACCTGATGAAGATTGGCTATCAGCTCAAGC
AGGTCCGCGAGCGACTCGCCAAGGGCCTCGTCGATAAGGGCATCCTGCGAACCGAAAAGCGCAACTTCCTCCTCT
TCGACATGGCCACCCATCCCGTGGCCGACGGCGGCGCAAAGGAAGAAATTCGTCGCCGCGTGCGGAACGTCCTGA
CGCAGCGCACCGTCGTCCTCAACAACAGTCAATTCCTGCCCGAGTCTCTCGACTTCCGCTACCTGCGCACCGTGT
CCATGGTCTGCGCCGCCTACGCCGCCAACGTGCTGGAGAATGCGCTTTCGACGCTCGGCCACGAAGCCCGCGAGC
GCGCCTTTGCCCAGACGGACGAGCTGCTGGCCGACTACAGCCAGTGGCCCTTTGGCAAGAAGGCTGTCGGCAATG
GCATCGGTGCCAATTTGCCCCAGGTCATCGCAGAGGTATGATCTGTCTTGCCTGTGTGAAGCTGACCCCTTTCGC
CGCCGCTGACTTTGGCCTTCAGGAGATTAGCCGCGCAAAGGACAAGGAGCTGCAGCTCGAGGTCGTCGCCGCTTG
TCTCAGCGTCTTTACCCGTCTGGACTCCTTGCTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail