Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1716
Gene name
Locationscaffold_164:560..1578
Strand-
Gene length (bp)1018
Transcript length (bp)978
Coding sequence length (bp)975
Protein length (aa) 325

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00782 DSPc Dual specificity phosphatase, catalytic domain 2.9E-08 197 246

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008138 protein tyrosine/serine/threonine phosphatase activity Yes
GO:0016311 dephosphorylation Yes
GO:0004721 phosphoprotein phosphatase activity No
GO:0016791 phosphatase activity No
GO:0016787 hydrolase activity No
GO:0009987 cellular process No
GO:0140096 catalytic activity, acting on a protein No
GO:0006793 phosphorus metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0003824 catalytic activity No
GO:0042578 phosphoric ester hydrolase activity No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016788 hydrolase activity, acting on ester bonds No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5793 0.6843 0.079 0.0665 0.4644 0.0017 0.1957 0.152 0.1161 0.0171

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5469
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6688
Ophiocordyceps australis map64 (Brazil) OphauB2|7190
Ophiocordyceps camponoti-floridani Ophcf2|06284
Ophiocordyceps camponoti-rufipedis Ophun1|4968
Ophiocordyceps kimflemingae Ophio5|1716 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6367

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1716
MDCEMALDDGEWMTAPPHQAIRMAPYSLQAPSPPALPVPVLPWRANEAAAAAAAAPAQMQLTPSVERVDPTQLTD
DDLFVITGGKTHVAVDRVFSWRYEDRRRAQPILDFLYLGPISVVRDDDFLRREAITLIVVARDARMADTRLVSLD
AATSRHDVVSCFVDIEYPSGMINAWTHAIRLINHHILTLHRSRGPGQRGKVLVSCETGNDRSAAIVVAYLMALFG
IGVVPAIQFTSVQRFCCCFDEDIKRLLLTCPCLVMPGSSSSSNXXXXXXXXXXPQPPPPPEVAVIPEAKVKRGLD
DDVADSMDADRFVGREYSAPFGEKS
Coding >Ophio5|1716
ATGGATTGCGAAATGGCTCTCGACGACGGCGAATGGATGACAGCGCCACCGCATCAGGCGATACGCATGGCTCCC
TACTCGCTGCAAGCGCCCAGTCCGCCTGCTCTCCCCGTACCGGTGCTGCCATGGCGAGCCAACGAGGCGGCGGCG
GCGGCGGCGGCGGCTCCGGCTCAGATGCAGTTGACGCCATCGGTTGAGCGTGTCGATCCGACGCAGTTGACGGAT
GATGACTTGTTTGTCATAACCGGGGGAAAGACGCATGTCGCTGTCGATCGCGTCTTTTCCTGGCGCTATGAGGAT
AGGCGTAGGGCGCAGCCTATTCTCGACTTTCTGTACCTTGGTCCCATCAGTGTTGTACGTGATGATGACTTTTTG
CGGCGAGAGGCTATTACCTTGATAGTAGTTGCGCGGGATGCTCGCATGGCCGATACGCGTCTCGTTAGTCTGGAC
GCCGCCACTTCTCGACATGATGTCGTCTCCTGCTTCGTCGATATCGAATATCCATCCGGAATGATCAACGCCTGG
ACGCACGCCATTCGTCTCATCAACCACCACATTCTCACCTTGCACCGGAGCCGTGGACCGGGTCAGCGGGGCAAG
GTGCTCGTCTCGTGCGAGACGGGAAACGACCGCTCGGCCGCCATCGTCGTCGCCTACCTCATGGCCCTCTTCGGC
ATCGGCGTCGTGCCCGCCATCCAATTCACCAGCGTACAACGCTTCTGCTGCTGCTTTGACGAGGACATCAAGCGA
CTCCTGCTGACCTGTCCCTGCCTCGTGATGCCTGGCAGCAGCAGCAGCAGCAACANNNNNNNNNNNNNNNNNNNN
NNNNNNNNNCCTCAACCGCCGCCGCCGCCCGAGGTGGCTGTCATCCCCGAGGCCAAGGTCAAGCGCGGCCTGGAC
GACGACGTGGCCGATTCCATGGATGCCGACCGGTTCGTCGGAAGGGAGTACTCGGCGCCGTTTGGAGAAAAGAGC
Transcript >Ophio5|1716
ATGGATTGCGAAATGGCTCTCGACGACGGCGAATGGATGACAGCGCCACCGCATCAGGCGATACGCATGGCTCCC
TACTCGCTGCAAGCGCCCAGTCCGCCTGCTCTCCCCGTACCGGTGCTGCCATGGCGAGCCAACGAGGCGGCGGCG
GCGGCGGCGGCGGCTCCGGCTCAGATGCAGTTGACGCCATCGGTTGAGCGTGTCGATCCGACGCAGTTGACGGAT
GATGACTTGTTTGTCATAACCGGGGGAAAGACGCATGTCGCTGTCGATCGCGTCTTTTCCTGGCGCTATGAGGAT
AGGCGTAGGGCGCAGCCTATTCTCGACTTTCTGTACCTTGGTCCCATCAGTGTTGTACGTGATGATGACTTTTTG
CGGCGAGAGGCTATTACCTTGATAGTAGTTGCGCGGGATGCTCGCATGGCCGATACGCGTCTCGTTAGTCTGGAC
GCCGCCACTTCTCGACATGATGTCGTCTCCTGCTTCGTCGATATCGAATATCCATCCGGAATGATCAACGCCTGG
ACGCACGCCATTCGTCTCATCAACCACCACATTCTCACCTTGCACCGGAGCCGTGGACCGGGTCAGCGGGGCAAG
GTGCTCGTCTCGTGCGAGACGGGAAACGACCGCTCGGCCGCCATCGTCGTCGCCTACCTCATGGCCCTCTTCGGC
ATCGGCGTCGTGCCCGCCATCCAATTCACCAGCGTACAACGCTTCTGCTGCTGCTTTGACGAGGACATCAAGCGA
CTCCTGCTGACCTGTCCCTGCCTCGTGATGCCTGGCAGCAGCAGCAGCAGCAACANNNNNNNNNNNNNNNNNNNN
NNNNNNNNNCCTCAACCGCCGCCGCCGCCCGAGGTGGCTGTCATCCCCGAGGCCAAGGTCAAGCGCGGCCTGGAC
GACGACGTGGCCGATTCCATGGATGCCGACCGGTTCGTCGGAAGGGAGTACTCGGCGCCGTTTGGAGAAAAGAGC
TGA
Gene >Ophio5|1716
ATGGATTGCGAAATGGCTCTCGACGACGGCGAATGGATGACAGCGCCACCGCATCAGGCGATACGCATGGCTCCC
TACTCGCTGCAAGCGCCCAGTCCGCCTGCTCTCCCCGTACCGGTGCTGCCATGGCGAGCCAACGAGGCGGCGGCG
GCGGCGGCGGCGGCTCCGGCTCAGATGCAGTTGACGCCATCGGTTGAGCGTGTCGATCCGACGCAGTTGACGGAT
GATGACTTGTTTGTCATAACCGGGGGAAAGACGCATGTCGCTGTCGATCGCGTCTTTTCCTGGCGCTATGAGGAT
AGGCGTAGGGCGCAGCCTATTCTCGACTTTCTGTACCTTGGTCCCATCAGTGTTGTACGTGATGATGACTTTTTG
CGGCGAGAGGCTATTACCTTGATAGTAGTTGCGCGGGATGCTCGCATGGCCGATACGCGTCTCGTTAGTCTGGAC
GCCGCCACTTCTCGACATGATGTCGTCTCCTGCTTCGTCGATATCGAATATCCATCCGGAATGATCAACGCCTGG
ACGCACGCCATTCGTCTCATCAACCACCACATTCTCACCTTGCACCGGAGCCGTGGACCGGGTCAGCGGGGCAAG
GTGCTCGTCTCGTGCGAGACGGGAAACGACCGCTCGGCCGCCATCGTCGTCGCCTACCTCATGGCCCTCTTCGGC
ATCGGCGTCGTGCCCGCCATCCAATTCACCAGCGTACAACGCTTCTGCTGCTGCTTTGACGAGGACATCAAGCGA
CTCCTGCTGACCTGGTGCGACATCCTCAAGGCTCGTCGCCTCGTCGCCTGTCAGTCCCTGCCTCGTGATGCCTGG
CAGCAGCAGCAGCAGCAACANNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCTCAACCGCCGCCGCCGCCCGAGGT
GGCTGTCATCCCCGAGGCCAAGGTCAAGCGCGGCCTGGACGACGACGTGGCCGATTCCATGGATGCCGACCGGTT
CGTCGGAAGGGAGTACTCGGCGCCGTTTGGAGAAAAGAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail