Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1714
Gene name
Locationscaffold_163:29127..31781
Strand+
Gene length (bp)2654
Transcript length (bp)2517
Coding sequence length (bp)2514
Protein length (aa) 838

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 1.6E-05 144 179

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P08638|LEUR_YEAST Regulatory protein LEU3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEU3 PE=1 SV=1 136 709 5.0E-38
sp|Q59UY7|SEF1_CANAL Transcriptional regulatory protein SEF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEF1 PE=1 SV=1 145 740 1.0E-21
sp|P87164|SEF1_KLULA Putative transcription factor SEF1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEF1 PE=3 SV=3 270 604 3.0E-15
sp|Q74Z37|SEF1_ASHGO Putative transcription factor SEF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEF1 PE=3 SV=1 270 613 2.0E-13
sp|P34228|SEF1_YEAST Putative transcription factor SEF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEF1 PE=1 SV=4 270 628 3.0E-11

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0008150 biological_process No
GO:0051252 regulation of RNA metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0019222 regulation of metabolic process No
GO:0050794 regulation of cellular process No
GO:0140110 transcription regulator activity No
GO:0031323 regulation of cellular metabolic process No
GO:0065007 biological regulation No
GO:0046872 metal ion binding No
GO:0010468 regulation of gene expression No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0005488 binding No
GO:0080090 regulation of primary metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0050789 regulation of biological process No
GO:0003700 DNA-binding transcription factor activity No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0046914 transition metal ion binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1714
MSPEPEVGAKIPTAAVSGRHRRLSAHAASTSPRRAVPSTSVSPRPPLAGAACGPDLGGICDGLSPTWSCRLGRMD
GSSIVARGGAASMSPTSPASSRPKRKRSSGLVAADSSPGSGLDDDDDHDHHDDDHDHAADRKRQPGVKRACNECR
QQKLRCDVVQEPFHSCSRCNRLKLACKIESNFKRVGKRSKHAEMEKEIDRLRRNVARARAQGFVVVDDDDEVDSP
VAPSTATYSHTRNPSLMGSDEAVSSLLHLKRGGSYNLPPAFSHELDGVRLTDNDVTHLFNEFFAFYHPFLPFLSP
QQPPDAYKQQHPLLFWSIVAVAARRFSPPDCPNLLTNLSGPMTRYLWTTIGEVPSNYHVVKAMCLLCTWPLPTST
TTSDPTHILCGVMMKTATGIGLHRPNHIRDFSRVSVELNKEQLHDRVTTWAVCNIVAQNIGTGYGQPASTLYDWT
LALRPGDDPALHLSRELEARLQIERFCDKVSKEMYSNASDPRGVAGDEHRAMLMRVYRRDFGELQASILSQQLGP
ISSLHLRAAALHMRLAGFFDSSTTPGYIDDLMGLWRAATSFLDDILEVDKVTSPRDALGATTGGTILLYATNYLQ
QMLVAAAFALLKLMRSFFCKTIDFDRGRSLFHHAIRSIRATSVVHNDLQWRLAELMVQMWNGARLDGNNCNNHGD
DESPIPVDDSLQLKVRCRHSMSLVFDSVWRWREEYQAQGRGSLENTKQPTNPDSANEASPSSSQLDGTLMPSHVP
PTSNPNSNSNSTANASNSNGNHLLGGNGALTPAGASGLSGGASGPNSMIGGGGLGYGDNGYDFFDPQHWMLDGLL
DFNYSYVPPLEGA
Coding >Ophio5|1714
ATGAGCCCTGAGCCTGAGGTTGGGGCCAAGATTCCGACCGCTGCAGTCTCTGGCCGCCATCGTCGTCTCTCCGCC
CACGCCGCCAGCACATCTCCCAGGCGGGCCGTACCGAGTACTTCTGTCTCACCTCGGCCTCCGCTGGCTGGCGCG
GCATGCGGCCCAGATCTGGGTGGTATCTGTGACGGCCTCTCCCCGACTTGGTCTTGTCGTCTTGGACGCATGGAC
GGCTCTTCTATCGTCGCCCGCGGGGGGGCCGCTTCGATGAGCCCGACAAGCCCCGCCAGCTCTCGGCCCAAGCGC
AAGCGCAGCAGCGGTCTGGTTGCCGCCGATAGCAGCCCCGGTAGCGGTCTGGACGACGACGACGATCACGATCAT
CACGACGACGACCATGATCATGCTGCTGACCGCAAGCGCCAGCCGGGAGTCAAGCGGGCCTGTAACGAATGTCGC
CAGCAAAAGCTCCGTTGCGATGTCGTCCAAGAACCCTTCCACAGCTGCTCTCGCTGCAACAGGCTCAAGCTCGCC
TGCAAGATCGAGTCCAACTTCAAGCGCGTTGGTAAACGGTCCAAACACGCCGAGATGGAAAAGGAAATCGACCGG
CTCCGGCGCAACGTCGCCCGCGCCCGCGCCCAGGGTTTCGTCGTCGTCGACGATGACGATGAGGTCGATTCGCCC
GTGGCCCCGAGCACCGCCACCTACTCCCACACGCGCAACCCTTCCCTCATGGGCTCCGATGAGGCCGTCTCTTCT
CTGCTGCACCTTAAGCGCGGCGGCTCCTACAACTTGCCTCCGGCCTTTTCGCACGAGCTCGACGGCGTACGGCTG
ACGGACAACGACGTCACCCACCTGTTCAACGAGTTCTTCGCCTTCTACCACCCCTTTCTACCTTTCCTCAGCCCC
CAGCAGCCGCCCGATGCCTACAAGCAGCAGCATCCGCTGCTCTTCTGGTCCATCGTCGCCGTCGCCGCCCGCCGC
TTCAGCCCGCCCGACTGCCCCAACCTGCTCACCAACCTGTCCGGGCCCATGACGCGCTACCTGTGGACCACCATT
GGCGAGGTTCCCAGCAATTATCACGTCGTCAAGGCCATGTGCCTGCTGTGCACCTGGCCCCTGCCCACGAGCACC
ACCACGTCGGATCCCACCCACATCCTCTGCGGCGTCATGATGAAGACGGCCACCGGCATCGGCCTGCACCGCCCC
AATCACATTCGCGACTTCTCGCGCGTATCCGTCGAGCTCAACAAGGAGCAGCTTCACGACCGAGTGACGACGTGG
GCCGTCTGCAACATCGTCGCCCAGAACATCGGCACCGGCTATGGCCAACCCGCCTCTACCCTCTACGACTGGACC
CTGGCTCTCCGGCCTGGCGACGACCCGGCCCTGCACCTTTCGCGCGAGCTCGAGGCTCGGCTCCAGATCGAGCGC
TTCTGCGACAAGGTGTCCAAGGAGATGTACAGCAACGCGAGCGACCCGCGCGGCGTCGCCGGCGACGAGCACCGC
GCCATGCTCATGCGCGTCTATCGCCGCGACTTTGGCGAGCTTCAGGCCTCGATCCTGTCGCAGCAGTTGGGGCCC
ATCTCCTCGCTACATCTGCGCGCAGCTGCTCTTCATATGCGCCTCGCCGGTTTCTTCGACTCGAGCACCACGCCG
GGCTACATCGACGACCTCATGGGCCTCTGGCGCGCTGCCACCAGCTTCCTCGACGACATCCTCGAGGTCGACAAG
GTGACGTCGCCCCGAGACGCCCTGGGCGCTACCACGGGCGGCACCATCCTGCTCTACGCGACAAACTACCTTCAG
CAGATGCTCGTCGCCGCCGCCTTTGCCCTGCTCAAGCTCATGCGCTCCTTTTTCTGCAAGACCATTGACTTTGAC
CGCGGCCGCAGCCTCTTCCACCACGCTATCCGCTCCATCCGCGCCACCAGCGTCGTCCACAACGACCTGCAGTGG
CGCCTGGCCGAGCTCATGGTCCAGATGTGGAACGGCGCCCGGCTCGACGGTAATAATTGCAACAATCACGGCGAC
GACGAATCGCCCATCCCGGTCGACGACAGCCTGCAGCTCAAGGTGCGCTGCCGCCACAGCATGAGCCTCGTCTTC
GATTCCGTCTGGCGATGGAGGGAGGAATATCAGGCTCAGGGTAGGGGCTCGCTCGAGAACACGAAGCAGCCGACG
AACCCGGACTCGGCCAACGAGGCCTCACCGTCGTCTTCACAGCTTGACGGCACCCTGATGCCCTCTCACGTGCCT
CCCACATCGAACCCCAATTCTAACAGCAACTCTACAGCCAACGCCAGCAATAGCAACGGCAACCACCTGCTCGGC
GGCAACGGCGCCCTGACACCGGCCGGCGCCTCGGGCCTCTCCGGCGGCGCCTCGGGCCCCAATAGCATGATTGGC
GGCGGCGGCCTCGGCTACGGCGACAACGGCTACGACTTTTTCGATCCGCAGCATTGGATGCTGGACGGTTTGCTC
GATTTCAATTACTCTTATGTGCCGCCGCTCGAGGGAGCC
Transcript >Ophio5|1714
ATGAGCCCTGAGCCTGAGGTTGGGGCCAAGATTCCGACCGCTGCAGTCTCTGGCCGCCATCGTCGTCTCTCCGCC
CACGCCGCCAGCACATCTCCCAGGCGGGCCGTACCGAGTACTTCTGTCTCACCTCGGCCTCCGCTGGCTGGCGCG
GCATGCGGCCCAGATCTGGGTGGTATCTGTGACGGCCTCTCCCCGACTTGGTCTTGTCGTCTTGGACGCATGGAC
GGCTCTTCTATCGTCGCCCGCGGGGGGGCCGCTTCGATGAGCCCGACAAGCCCCGCCAGCTCTCGGCCCAAGCGC
AAGCGCAGCAGCGGTCTGGTTGCCGCCGATAGCAGCCCCGGTAGCGGTCTGGACGACGACGACGATCACGATCAT
CACGACGACGACCATGATCATGCTGCTGACCGCAAGCGCCAGCCGGGAGTCAAGCGGGCCTGTAACGAATGTCGC
CAGCAAAAGCTCCGTTGCGATGTCGTCCAAGAACCCTTCCACAGCTGCTCTCGCTGCAACAGGCTCAAGCTCGCC
TGCAAGATCGAGTCCAACTTCAAGCGCGTTGGTAAACGGTCCAAACACGCCGAGATGGAAAAGGAAATCGACCGG
CTCCGGCGCAACGTCGCCCGCGCCCGCGCCCAGGGTTTCGTCGTCGTCGACGATGACGATGAGGTCGATTCGCCC
GTGGCCCCGAGCACCGCCACCTACTCCCACACGCGCAACCCTTCCCTCATGGGCTCCGATGAGGCCGTCTCTTCT
CTGCTGCACCTTAAGCGCGGCGGCTCCTACAACTTGCCTCCGGCCTTTTCGCACGAGCTCGACGGCGTACGGCTG
ACGGACAACGACGTCACCCACCTGTTCAACGAGTTCTTCGCCTTCTACCACCCCTTTCTACCTTTCCTCAGCCCC
CAGCAGCCGCCCGATGCCTACAAGCAGCAGCATCCGCTGCTCTTCTGGTCCATCGTCGCCGTCGCCGCCCGCCGC
TTCAGCCCGCCCGACTGCCCCAACCTGCTCACCAACCTGTCCGGGCCCATGACGCGCTACCTGTGGACCACCATT
GGCGAGGTTCCCAGCAATTATCACGTCGTCAAGGCCATGTGCCTGCTGTGCACCTGGCCCCTGCCCACGAGCACC
ACCACGTCGGATCCCACCCACATCCTCTGCGGCGTCATGATGAAGACGGCCACCGGCATCGGCCTGCACCGCCCC
AATCACATTCGCGACTTCTCGCGCGTATCCGTCGAGCTCAACAAGGAGCAGCTTCACGACCGAGTGACGACGTGG
GCCGTCTGCAACATCGTCGCCCAGAACATCGGCACCGGCTATGGCCAACCCGCCTCTACCCTCTACGACTGGACC
CTGGCTCTCCGGCCTGGCGACGACCCGGCCCTGCACCTTTCGCGCGAGCTCGAGGCTCGGCTCCAGATCGAGCGC
TTCTGCGACAAGGTGTCCAAGGAGATGTACAGCAACGCGAGCGACCCGCGCGGCGTCGCCGGCGACGAGCACCGC
GCCATGCTCATGCGCGTCTATCGCCGCGACTTTGGCGAGCTTCAGGCCTCGATCCTGTCGCAGCAGTTGGGGCCC
ATCTCCTCGCTACATCTGCGCGCAGCTGCTCTTCATATGCGCCTCGCCGGTTTCTTCGACTCGAGCACCACGCCG
GGCTACATCGACGACCTCATGGGCCTCTGGCGCGCTGCCACCAGCTTCCTCGACGACATCCTCGAGGTCGACAAG
GTGACGTCGCCCCGAGACGCCCTGGGCGCTACCACGGGCGGCACCATCCTGCTCTACGCGACAAACTACCTTCAG
CAGATGCTCGTCGCCGCCGCCTTTGCCCTGCTCAAGCTCATGCGCTCCTTTTTCTGCAAGACCATTGACTTTGAC
CGCGGCCGCAGCCTCTTCCACCACGCTATCCGCTCCATCCGCGCCACCAGCGTCGTCCACAACGACCTGCAGTGG
CGCCTGGCCGAGCTCATGGTCCAGATGTGGAACGGCGCCCGGCTCGACGGTAATAATTGCAACAATCACGGCGAC
GACGAATCGCCCATCCCGGTCGACGACAGCCTGCAGCTCAAGGTGCGCTGCCGCCACAGCATGAGCCTCGTCTTC
GATTCCGTCTGGCGATGGAGGGAGGAATATCAGGCTCAGGGTAGGGGCTCGCTCGAGAACACGAAGCAGCCGACG
AACCCGGACTCGGCCAACGAGGCCTCACCGTCGTCTTCACAGCTTGACGGCACCCTGATGCCCTCTCACGTGCCT
CCCACATCGAACCCCAATTCTAACAGCAACTCTACAGCCAACGCCAGCAATAGCAACGGCAACCACCTGCTCGGC
GGCAACGGCGCCCTGACACCGGCCGGCGCCTCGGGCCTCTCCGGCGGCGCCTCGGGCCCCAATAGCATGATTGGC
GGCGGCGGCCTCGGCTACGGCGACAACGGCTACGACTTTTTCGATCCGCAGCATTGGATGCTGGACGGTTTGCTC
GATTTCAATTACTCTTATGTGCCGCCGCTCGAGGGAGCCTAG
Gene >Ophio5|1714
ATGAGCCCTGAGCCTGAGGTTGGGGCCAAGATTCCGACCGCTGCAGTCTCTGGCCGCCATCGTCGTCTCTCCGCC
CACGCCGCCAGCACATCTCCCAGGCGGGCCGTACCGAGTACTTCTGTCTCACCTCGGCCTCCGCTGGCTGGCGCG
GCATGCGGCCCAGATCTGGGTGGTATCTGTGACGGCCTCTCCCCGACTTGGTCTTGTCGTCTTGGACGCATGGAC
GGCTCTTCTATCGTCGCCCGCGGGGGGGCCGCTTCGATGAGCCCGACAAGCCCCGCCAGCTCTCGGCCCAAGCGC
AAGCGCAGCAGCGGTCTGGTTGCCGCCGATAGCAGCCCCGGTAGCGGTCTGGACGACGACGACGATCACGATCAT
CACGACGACGACCATGATCATGCTGCTGACCGCAAGCGCCAGCCGGGAGTCAAGCGGGCCTGTAACGAATGTCGC
CAGCAAAAGGCGAGTCTCTCCTGTTCTCCTACATCTCCTCCCACTGACGGACGACTGACCTCCCTTGATAGCTCC
GTTGCGATGTCGTCCAAGAACCCTTCCACAGCTGCTCTCGCTGCAACAGGCTCAAGCTCGCCTGCAAGATCGAGT
CCAACTTCAAGCGCGTTGGTAAACGGTCCAAACACGCCGAGATGGAAAAGGAAATCGACCGGCTCCGGCGCAACG
TCGCCCGCGCCCGCGCCCAGGGTTTCGTCGTCGTCGACGATGACGATGAGGTCGATTCGCCCGTGGCCCCGAGCA
CCGCCACCTACTCCCACACGCGCAACCCTTCCCTCATGGGCTCCGATGAGGCCGTCTCTTCTCTGCTGCACCTTA
AGCGCGGCGGCTCCTACAACTTGCCTCCGGCCTTTTCGCACGAGCTCGACGGCGTACGGCTGACGGACAACGACG
TCACCCACCTGTTCAACGAGTTCTTCGCCTTCTACCACCCCTTTCTACCTTTCCTCAGCCCCCAGCAGCCGCCCG
ATGCCTACAAGCAGCAGCATCCGCTGCTCTTCTGGTCCATCGTCGCCGTCGCCGCCCGCCGCTTCAGCCCGCCCG
ACTGCCCCAACCTGCTCACCAACCTGTCCGGGCCCATGACGCGCTACCTGTGGACCACCATTGGCGAGGTTCCCA
GCAATTATCACGTCGTCAAGGCCATGTGCCTGCTGTGCACCTGGCCCCTGCCCACGAGCACCACCACGTCGGATC
CCACCCACATCCTCTGCGGCGTCATGATGAAGACGGCCACCGGCATCGGCCTGCACCGCCCCAATCACATTCGCG
ACTTCTCGCGCGTATCCGTCGAGCTCAACAAGGAGCAGCTTCACGACCGAGTGACGACGTGGGCCGTCTGCAACA
TCGTCGCCCAGAACATCGGCACCGGCTATGGCCAACCCGCCTCTACCCTCTACGACTGGACCCTGGCTCTCCGGC
CTGGCGACGACCCGGCCCTGCACCTTTCGCGCGAGCTCGAGGCTCGGCTCCAGATCGAGCGCTTCTGCGACAAGG
TGTCCAAGGAGATGTACAGCAACGCGAGCGACCCGCGCGGCGTCGCCGGCGACGAGCACCGCGCCATGCTCATGC
GCGTCTATCGCCGCGACTTTGGCGAGCTTCAGGCCTCGATCCTGTCGCAGCAGTTGGGGCCCATCTCCTCGCTAC
ATCTGCGCGCAGCTGCTCTTCATATGCGCCTCGCCGGTTTCTTCGACTCGAGCACCACGCCGGGCTACATCGACG
ACCTCATGGGCCTCTGGCGCGCTGCCACCAGCTTCCTCGACGACATCCTCGAGGTCGACAAGGTGACGTCGCCCC
GAGACGCCCTGGGCGCTACCACGGGCGGCACCATCCTGCTCTACGCGACAAACTACCTTCAGCAGATGCTCGTCG
CCGCCGCCTTTGCCCTGCTCAAGCTCATGCGCTCCTTTTTCTGCAAGACCATTGACTTTGACCGCGGCCGCAGCC
TCTTCCACCACGCTATCCGCTCCATCCGCGCCACCAGCGTCGTCCACAACGACCTGCAGTGGCGCCTGGCCGAGC
TCATGGTCCAGATGTGGAACGGCGCCCGGCTCGACGGTAATAATTGCAACAATCACGGCGACGACGAATCGCCCA
TCCCGGTCGACGACAGCCTGCAGCTCAAGGTGCGCTGCCGCCACAGCATGAGCCTCGTCTTCGATTCCGTCTGGC
GATGGAGGGAGGAATATCAGGCTCAGGGTAGGGGCTCGCTCGAGAGTGAGTTGATGGGGCCTGCCGCTTGGCCTA
CCATCAGAGTACTCGCCGCTGACTACCTCATTTTGCTCTTACCAGACACGAAGCAGCCGACGAACCCGGACTCGG
CCAACGAGGCCTCACCGTCGTCTTCACAGCTTGACGGCACCCTGATGCCCTCTCACGTGCCTCCCACATCGAACC
CCAATTCTAACAGCAACTCTACAGCCAACGCCAGCAATAGCAACGGCAACCACCTGCTCGGCGGCAACGGCGCCC
TGACACCGGCCGGCGCCTCGGGCCTCTCCGGCGGCGCCTCGGGCCCCAATAGCATGATTGGCGGCGGCGGCCTCG
GCTACGGCGACAACGGCTACGACTTTTTCGATCCGCAGCATTGGATGCTGGACGGTTTGCTCGATTTCAATTACT
CTTATGTGCCGCCGCTCGAGGGAGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail