Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1710
Gene name
Locationscaffold_163:17726..20138
Strand-
Gene length (bp)2412
Transcript length (bp)2412
Coding sequence length (bp)2409
Protein length (aa) 803

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6047 0.5738 0.0745 0.0646 0.2956 0.0347 0.0823 0.1913 0.1883 0.0298

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6585
Change Orthofinder run
Species Protein ID
Ophiocordyceps kimflemingae Ophio5|1710 (this protein)
Ophiocordyceps subramaniannii Hirsu2|31
Ophiocordyceps subramaniannii Hirsu2|6622

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1710
MTPSSASTSPLCYEVAIVGNGPRGASLNMNAILVALAEAESFKAIQTRGNSFKVRFHTFEKKPWQKRAVGNAFSP
TCHAAVNTPVVGPSDTQIPNLDKVQMQYANIVHRATDLGYYLGKHVESNWTDIMADYERVNTAAAACLRRATRLD
GSVDVSLPCVTRGTLGTVLQSQFDTVIRDGSKAVPFLDFNFYYEVEVVSYDVTTNRSKPCLVTRPVRGGRMKKRI
FDHIVLAGGTVLENPVSGRLLERTYLGEANFDDIRSFYRRLGLLLPDESLDPKARVLILGMGLSAIDKATVGSRS
AGFARSSESDPSGFEMIDGEVDKYAGSFTMMSRSPCRFVAPRQVFHQRWLSPTYQPLSQLAVRAAFMDDSPSTLS
RLLCVLYAAVARALGTTPDKNPLFLQTPLDFQLQTFEDNVRHLNSITPETGAQTWSGYLRSGMLSITHGGGVQGS
KKHKDDGLLQQMTKGRDGFMVLRSMASHYSKPKVLASGSNADFVTAWERAVYPYVGASPVPVAHYFASMFKTGVS
SHLKASFEELEICPETGKVKCGGQLFDCVLGSRVIPIHLKSKPRISRTSQLKESVPNKPALAKGRIYQNRNGELC
NATELGIIGHGIIGKDEAGNTILQDANWLDTHSHASAVQTSPNIIKYIFTKAALTANGCQDAATEVQVRYATTLL
SDSEYYKAANKLRQAHRELHETVAYCRFCTDLANGDASIFAAAFDRIETAASRDAFVRLHGGVLSDPNSCGARYF
AHLRTIPPYKPKSRQEYYDDYIDFTCHEIHEIWTHVCRDLIEMKTEYTQEEKL
Coding >Ophio5|1710
ATGACGCCAAGTTCAGCATCCACGTCTCCCTTGTGTTACGAGGTGGCAATCGTCGGCAACGGCCCACGGGGAGCT
TCTCTCAATATGAACGCCATCTTGGTTGCACTGGCCGAGGCTGAGAGCTTCAAGGCGATACAAACTCGCGGCAAT
TCCTTCAAAGTCCGCTTTCACACTTTTGAAAAAAAGCCATGGCAGAAACGAGCGGTTGGAAACGCCTTTTCACCT
ACGTGTCATGCCGCCGTGAACACCCCAGTTGTCGGTCCTTCTGATACTCAGATCCCGAACCTAGACAAAGTCCAG
ATGCAATACGCCAATATTGTCCATCGGGCAACAGACCTCGGTTACTACCTTGGCAAGCACGTCGAGTCGAATTGG
ACGGATATCATGGCCGACTACGAGCGTGTGAACACCGCTGCAGCGGCTTGTCTGCGACGCGCTACACGCCTTGAC
GGATCCGTCGACGTTTCTCTGCCTTGTGTCACTCGTGGAACGCTTGGGACAGTCCTTCAAAGTCAGTTTGACACG
GTGATACGGGATGGATCGAAAGCAGTACCTTTTCTCGACTTCAACTTTTACTACGAGGTCGAAGTCGTCTCCTAC
GATGTCACTACCAACCGCTCGAAGCCTTGTCTCGTCACCAGGCCGGTTAGAGGCGGACGGATGAAAAAACGCATC
TTCGACCACATCGTTCTAGCTGGAGGAACCGTGCTGGAAAATCCTGTTTCGGGCCGTCTTCTGGAACGAACCTAT
CTTGGTGAGGCTAACTTTGACGACATCCGAAGCTTCTACCGCAGACTGGGACTTCTCCTTCCCGATGAAAGCCTC
GATCCAAAGGCAAGGGTTCTCATTCTCGGCATGGGTCTTTCAGCCATAGACAAAGCTACCGTCGGCAGCCGGTCC
GCCGGCTTCGCGCGAAGCTCGGAAAGCGACCCTTCTGGGTTCGAGATGATTGACGGTGAAGTAGACAAATACGCC
GGAAGCTTTACCATGATGAGCCGCAGCCCTTGTCGGTTTGTGGCACCTCGACAGGTCTTCCATCAACGCTGGCTA
AGCCCGACGTATCAGCCGCTGAGCCAGCTCGCCGTCAGGGCTGCTTTCATGGACGACTCTCCATCAACGTTATCG
CGCCTCTTGTGCGTCTTGTACGCCGCAGTCGCACGCGCACTAGGCACGACACCGGATAAGAACCCCCTGTTTCTT
CAAACGCCCTTGGATTTTCAGCTCCAAACATTCGAGGACAATGTTCGACACCTGAACAGCATTACCCCTGAAACC
GGTGCCCAGACGTGGTCGGGCTATTTACGATCTGGCATGCTATCCATCACCCACGGCGGGGGCGTCCAGGGCTCA
AAAAAGCACAAGGACGATGGCCTTCTCCAGCAGATGACCAAAGGACGCGACGGATTCATGGTCCTTCGCTCTATG
GCTTCACACTACTCCAAACCCAAAGTTCTAGCAAGCGGGTCTAACGCCGACTTCGTCACAGCTTGGGAGCGTGCC
GTGTACCCTTACGTTGGCGCATCACCGGTGCCTGTGGCTCACTACTTCGCTTCCATGTTCAAGACTGGGGTTTCC
TCCCACTTGAAGGCATCTTTCGAGGAACTTGAAATCTGTCCCGAGACTGGCAAAGTAAAATGCGGCGGGCAATTA
TTCGACTGTGTCCTCGGCTCCAGGGTTATCCCTATTCACCTGAAAAGCAAACCACGCATATCTCGGACCAGCCAG
CTCAAGGAGTCGGTTCCCAATAAACCAGCATTGGCCAAGGGGCGTATCTACCAGAATCGCAACGGAGAGCTATGC
AATGCTACGGAATTGGGCATTATCGGCCATGGAATCATTGGGAAAGACGAGGCCGGCAATACCATTCTCCAGGAC
GCCAACTGGTTAGACACGCACAGCCACGCCAGCGCCGTCCAAACATCGCCAAACATCATCAAGTACATCTTCACA
AAGGCCGCACTCACTGCCAACGGTTGCCAAGATGCTGCAACCGAGGTCCAGGTCCGATACGCGACAACTCTTCTC
TCAGACAGCGAATACTACAAGGCTGCCAACAAGCTCAGACAGGCGCATCGTGAACTTCACGAGACAGTGGCCTAC
TGTCGCTTTTGTACCGACTTGGCCAACGGAGACGCGTCGATATTTGCTGCGGCCTTTGACCGGATCGAAACGGCC
GCCAGTCGTGACGCCTTTGTACGACTTCACGGAGGTGTCTTGTCCGACCCCAATAGCTGCGGCGCCAGATACTTT
GCCCATCTCCGCACAATCCCTCCCTATAAACCGAAATCACGGCAAGAATACTACGATGACTATATCGATTTTACA
TGCCACGAAATACATGAAATCTGGACACATGTTTGTCGTGACTTGATAGAAATGAAGACCGAATACACACAGGAA
GAAAAACTG
Transcript >Ophio5|1710
ATGACGCCAAGTTCAGCATCCACGTCTCCCTTGTGTTACGAGGTGGCAATCGTCGGCAACGGCCCACGGGGAGCT
TCTCTCAATATGAACGCCATCTTGGTTGCACTGGCCGAGGCTGAGAGCTTCAAGGCGATACAAACTCGCGGCAAT
TCCTTCAAAGTCCGCTTTCACACTTTTGAAAAAAAGCCATGGCAGAAACGAGCGGTTGGAAACGCCTTTTCACCT
ACGTGTCATGCCGCCGTGAACACCCCAGTTGTCGGTCCTTCTGATACTCAGATCCCGAACCTAGACAAAGTCCAG
ATGCAATACGCCAATATTGTCCATCGGGCAACAGACCTCGGTTACTACCTTGGCAAGCACGTCGAGTCGAATTGG
ACGGATATCATGGCCGACTACGAGCGTGTGAACACCGCTGCAGCGGCTTGTCTGCGACGCGCTACACGCCTTGAC
GGATCCGTCGACGTTTCTCTGCCTTGTGTCACTCGTGGAACGCTTGGGACAGTCCTTCAAAGTCAGTTTGACACG
GTGATACGGGATGGATCGAAAGCAGTACCTTTTCTCGACTTCAACTTTTACTACGAGGTCGAAGTCGTCTCCTAC
GATGTCACTACCAACCGCTCGAAGCCTTGTCTCGTCACCAGGCCGGTTAGAGGCGGACGGATGAAAAAACGCATC
TTCGACCACATCGTTCTAGCTGGAGGAACCGTGCTGGAAAATCCTGTTTCGGGCCGTCTTCTGGAACGAACCTAT
CTTGGTGAGGCTAACTTTGACGACATCCGAAGCTTCTACCGCAGACTGGGACTTCTCCTTCCCGATGAAAGCCTC
GATCCAAAGGCAAGGGTTCTCATTCTCGGCATGGGTCTTTCAGCCATAGACAAAGCTACCGTCGGCAGCCGGTCC
GCCGGCTTCGCGCGAAGCTCGGAAAGCGACCCTTCTGGGTTCGAGATGATTGACGGTGAAGTAGACAAATACGCC
GGAAGCTTTACCATGATGAGCCGCAGCCCTTGTCGGTTTGTGGCACCTCGACAGGTCTTCCATCAACGCTGGCTA
AGCCCGACGTATCAGCCGCTGAGCCAGCTCGCCGTCAGGGCTGCTTTCATGGACGACTCTCCATCAACGTTATCG
CGCCTCTTGTGCGTCTTGTACGCCGCAGTCGCACGCGCACTAGGCACGACACCGGATAAGAACCCCCTGTTTCTT
CAAACGCCCTTGGATTTTCAGCTCCAAACATTCGAGGACAATGTTCGACACCTGAACAGCATTACCCCTGAAACC
GGTGCCCAGACGTGGTCGGGCTATTTACGATCTGGCATGCTATCCATCACCCACGGCGGGGGCGTCCAGGGCTCA
AAAAAGCACAAGGACGATGGCCTTCTCCAGCAGATGACCAAAGGACGCGACGGATTCATGGTCCTTCGCTCTATG
GCTTCACACTACTCCAAACCCAAAGTTCTAGCAAGCGGGTCTAACGCCGACTTCGTCACAGCTTGGGAGCGTGCC
GTGTACCCTTACGTTGGCGCATCACCGGTGCCTGTGGCTCACTACTTCGCTTCCATGTTCAAGACTGGGGTTTCC
TCCCACTTGAAGGCATCTTTCGAGGAACTTGAAATCTGTCCCGAGACTGGCAAAGTAAAATGCGGCGGGCAATTA
TTCGACTGTGTCCTCGGCTCCAGGGTTATCCCTATTCACCTGAAAAGCAAACCACGCATATCTCGGACCAGCCAG
CTCAAGGAGTCGGTTCCCAATAAACCAGCATTGGCCAAGGGGCGTATCTACCAGAATCGCAACGGAGAGCTATGC
AATGCTACGGAATTGGGCATTATCGGCCATGGAATCATTGGGAAAGACGAGGCCGGCAATACCATTCTCCAGGAC
GCCAACTGGTTAGACACGCACAGCCACGCCAGCGCCGTCCAAACATCGCCAAACATCATCAAGTACATCTTCACA
AAGGCCGCACTCACTGCCAACGGTTGCCAAGATGCTGCAACCGAGGTCCAGGTCCGATACGCGACAACTCTTCTC
TCAGACAGCGAATACTACAAGGCTGCCAACAAGCTCAGACAGGCGCATCGTGAACTTCACGAGACAGTGGCCTAC
TGTCGCTTTTGTACCGACTTGGCCAACGGAGACGCGTCGATATTTGCTGCGGCCTTTGACCGGATCGAAACGGCC
GCCAGTCGTGACGCCTTTGTACGACTTCACGGAGGTGTCTTGTCCGACCCCAATAGCTGCGGCGCCAGATACTTT
GCCCATCTCCGCACAATCCCTCCCTATAAACCGAAATCACGGCAAGAATACTACGATGACTATATCGATTTTACA
TGCCACGAAATACATGAAATCTGGACACATGTTTGTCGTGACTTGATAGAAATGAAGACCGAATACACACAGGAA
GAAAAACTGTAA
Gene >Ophio5|1710
ATGACGCCAAGTTCAGCATCCACGTCTCCCTTGTGTTACGAGGTGGCAATCGTCGGCAACGGCCCACGGGGAGCT
TCTCTCAATATGAACGCCATCTTGGTTGCACTGGCCGAGGCTGAGAGCTTCAAGGCGATACAAACTCGCGGCAAT
TCCTTCAAAGTCCGCTTTCACACTTTTGAAAAAAAGCCATGGCAGAAACGAGCGGTTGGAAACGCCTTTTCACCT
ACGTGTCATGCCGCCGTGAACACCCCAGTTGTCGGTCCTTCTGATACTCAGATCCCGAACCTAGACAAAGTCCAG
ATGCAATACGCCAATATTGTCCATCGGGCAACAGACCTCGGTTACTACCTTGGCAAGCACGTCGAGTCGAATTGG
ACGGATATCATGGCCGACTACGAGCGTGTGAACACCGCTGCAGCGGCTTGTCTGCGACGCGCTACACGCCTTGAC
GGATCCGTCGACGTTTCTCTGCCTTGTGTCACTCGTGGAACGCTTGGGACAGTCCTTCAAAGTCAGTTTGACACG
GTGATACGGGATGGATCGAAAGCAGTACCTTTTCTCGACTTCAACTTTTACTACGAGGTCGAAGTCGTCTCCTAC
GATGTCACTACCAACCGCTCGAAGCCTTGTCTCGTCACCAGGCCGGTTAGAGGCGGACGGATGAAAAAACGCATC
TTCGACCACATCGTTCTAGCTGGAGGAACCGTGCTGGAAAATCCTGTTTCGGGCCGTCTTCTGGAACGAACCTAT
CTTGGTGAGGCTAACTTTGACGACATCCGAAGCTTCTACCGCAGACTGGGACTTCTCCTTCCCGATGAAAGCCTC
GATCCAAAGGCAAGGGTTCTCATTCTCGGCATGGGTCTTTCAGCCATAGACAAAGCTACCGTCGGCAGCCGGTCC
GCCGGCTTCGCGCGAAGCTCGGAAAGCGACCCTTCTGGGTTCGAGATGATTGACGGTGAAGTAGACAAATACGCC
GGAAGCTTTACCATGATGAGCCGCAGCCCTTGTCGGTTTGTGGCACCTCGACAGGTCTTCCATCAACGCTGGCTA
AGCCCGACGTATCAGCCGCTGAGCCAGCTCGCCGTCAGGGCTGCTTTCATGGACGACTCTCCATCAACGTTATCG
CGCCTCTTGTGCGTCTTGTACGCCGCAGTCGCACGCGCACTAGGCACGACACCGGATAAGAACCCCCTGTTTCTT
CAAACGCCCTTGGATTTTCAGCTCCAAACATTCGAGGACAATGTTCGACACCTGAACAGCATTACCCCTGAAACC
GGTGCCCAGACGTGGTCGGGCTATTTACGATCTGGCATGCTATCCATCACCCACGGCGGGGGCGTCCAGGGCTCA
AAAAAGCACAAGGACGATGGCCTTCTCCAGCAGATGACCAAAGGACGCGACGGATTCATGGTCCTTCGCTCTATG
GCTTCACACTACTCCAAACCCAAAGTTCTAGCAAGCGGGTCTAACGCCGACTTCGTCACAGCTTGGGAGCGTGCC
GTGTACCCTTACGTTGGCGCATCACCGGTGCCTGTGGCTCACTACTTCGCTTCCATGTTCAAGACTGGGGTTTCC
TCCCACTTGAAGGCATCTTTCGAGGAACTTGAAATCTGTCCCGAGACTGGCAAAGTAAAATGCGGCGGGCAATTA
TTCGACTGTGTCCTCGGCTCCAGGGTTATCCCTATTCACCTGAAAAGCAAACCACGCATATCTCGGACCAGCCAG
CTCAAGGAGTCGGTTCCCAATAAACCAGCATTGGCCAAGGGGCGTATCTACCAGAATCGCAACGGAGAGCTATGC
AATGCTACGGAATTGGGCATTATCGGCCATGGAATCATTGGGAAAGACGAGGCCGGCAATACCATTCTCCAGGAC
GCCAACTGGTTAGACACGCACAGCCACGCCAGCGCCGTCCAAACATCGCCAAACATCATCAAGTACATCTTCACA
AAGGCCGCACTCACTGCCAACGGTTGCCAAGATGCTGCAACCGAGGTCCAGGTCCGATACGCGACAACTCTTCTC
TCAGACAGCGAATACTACAAGGCTGCCAACAAGCTCAGACAGGCGCATCGTGAACTTCACGAGACAGTGGCCTAC
TGTCGCTTTTGTACCGACTTGGCCAACGGAGACGCGTCGATATTTGCTGCGGCCTTTGACCGGATCGAAACGGCC
GCCAGTCGTGACGCCTTTGTACGACTTCACGGAGGTGTCTTGTCCGACCCCAATAGCTGCGGCGCCAGATACTTT
GCCCATCTCCGCACAATCCCTCCCTATAAACCGAAATCACGGCAAGAATACTACGATGACTATATCGATTTTACA
TGCCACGAAATACATGAAATCTGGACACATGTTTGTCGTGACTTGATAGAAATGAAGACCGAATACACACAGGAA
GAAAAACTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail