Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1703
Gene name
Locationscaffold_163:4195..6087
Strand+
Gene length (bp)1892
Transcript length (bp)1335
Coding sequence length (bp)1332
Protein length (aa) 444

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13938|YEP4_SCHPO UPF0658 Golgi apparatus membrane protein C23H3.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23H3.04 PE=3 SV=3 104 414 1.0E-47
sp|Q9UUJ8|YLOA_SCHPO UPF0658 Golgi apparatus membrane protein C1952.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1952.10c PE=3 SV=1 106 444 8.0E-28

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 109 131 22
2 155 174 19
3 181 203 22
4 235 257 22
5 283 305 22
6 315 334 19
7 341 359 18
8 379 401 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 111.02 60.43 161.62
CcL In ants, during behavior modification 185.11 93.72 276.51
CcD In ants, recently dead 121.99 66.19 177.78

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.025485 yes
SC16a CcD 0.724650 no
CcL CcD 0.075415 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1703
MPRKKQKKKRRNHALSPFRLPLSRPACGYFFLIDDDDDNSPLTPGRSRPVARPGYQALLVRPKLKPAYAENANLN
AGFDQGYAYRQGFAPSTPARSVYRDRMSFLKSKWPAAFMAVTSLQAIVCLAFESFVFARFQSSLGRWVDKLSVQS
QYKTIPTFLTLIIFGFLYELVVVWDALRMKNTIQVIGVCIANLALLVYTAIQVDQIQMAINTLGAEALKPGITPE
EVWANVRPFLVAIPAIIALATAAMVFIAWKLYQEFAWDILKNIGADYRMKKRFLHYQIYIALLKFDFFFFLGFII
QFVVIVAQKTDPEFALTIATIPITICILLAAAYFTRRENKLGMMAVIILYLGGLIYFIFKLVRIYQPEYRLFYLP
VRKSLTAFAVITILLILLTIANAIICMRNFDKGLKAHLLSPRRMDEKPDAHSISLHDVKPQIPSRMTID
Coding >Ophio5|1703
ATGCCTAGGAAGAAGCAAAAAAAGAAAAGGCGCAACCACGCCCTTTCACCCTTCCGTCTTCCCCTCTCTCGCCCT
GCGTGCGGATACTTCTTCCTCATCGACGACGACGACGACAACTCTCCGTTGACTCCCGGTCGGAGTCGCCCAGTC
GCCCGTCCTGGCTACCAGGCCCTCCTCGTTCGACCAAAACTCAAACCCGCCTACGCGGAGAATGCGAATCTAAAC
GCTGGCTTCGACCAGGGCTACGCCTATCGCCAAGGCTTCGCCCCTTCCACACCGGCGAGGAGCGTCTATCGCGAC
AGGATGAGCTTCCTCAAGTCCAAATGGCCCGCCGCCTTCATGGCTGTCACCAGCCTCCAGGCCATTGTCTGCTTG
GCATTCGAGTCATTCGTCTTTGCGCGCTTCCAATCCAGTCTCGGCCGCTGGGTCGATAAGCTTTCCGTCCAGTCC
CAATACAAGACGATCCCGACTTTCCTGACCCTCATCATCTTCGGCTTCCTGTATGAACTGGTCGTCGTCTGGGAT
GCGTTGCGCATGAAGAACACCATTCAGGTCATTGGCGTCTGCATCGCTAATCTGGCCTTGCTCGTCTACACCGCC
ATCCAGGTCGACCAGATCCAGATGGCCATCAACACCCTCGGCGCCGAGGCCCTTAAACCCGGCATCACTCCCGAA
GAGGTCTGGGCCAACGTCAGGCCCTTCCTTGTCGCCATCCCGGCCATCATTGCCCTGGCCACCGCCGCCATGGTC
TTTATCGCCTGGAAGCTCTACCAGGAGTTCGCCTGGGATATCCTCAAAAACATTGGCGCTGACTATCGCATGAAG
AAGCGTTTCCTCCATTACCAGATTTACATCGCACTGCTCAAGTTCGACTTCTTCTTCTTCCTCGGCTTCATCATC
CAGTTCGTCGTCATCGTCGCCCAAAAGACGGATCCCGAGTTCGCCCTGACCATCGCCACCATCCCCATCACCATC
TGCATTCTCCTCGCCGCTGCCTACTTCACCCGCCGCGAGAATAAGCTGGGCATGATGGCTGTCATAATCCTCTAC
CTGGGCGGACTCATATACTTCATCTTCAAGCTCGTCCGCATCTACCAGCCCGAATACAGGCTCTTCTACTTGCCC
GTGCGCAAATCTCTCACCGCCTTCGCCGTCATCACCATCCTATTGATTCTACTCACCATTGCAAACGCCATCATC
TGCATGCGCAACTTCGACAAGGGCCTCAAGGCCCACTTGCTGTCCCCGCGCCGAATGGACGAGAAGCCCGACGCT
CATTCCATCAGCCTGCACGACGTCAAGCCGCAAATTCCCAGTCGGATGACCATCGAC
Transcript >Ophio5|1703
ATGCCTAGGAAGAAGCAAAAAAAGAAAAGGCGCAACCACGCCCTTTCACCCTTCCGTCTTCCCCTCTCTCGCCCT
GCGTGCGGATACTTCTTCCTCATCGACGACGACGACGACAACTCTCCGTTGACTCCCGGTCGGAGTCGCCCAGTC
GCCCGTCCTGGCTACCAGGCCCTCCTCGTTCGACCAAAACTCAAACCCGCCTACGCGGAGAATGCGAATCTAAAC
GCTGGCTTCGACCAGGGCTACGCCTATCGCCAAGGCTTCGCCCCTTCCACACCGGCGAGGAGCGTCTATCGCGAC
AGGATGAGCTTCCTCAAGTCCAAATGGCCCGCCGCCTTCATGGCTGTCACCAGCCTCCAGGCCATTGTCTGCTTG
GCATTCGAGTCATTCGTCTTTGCGCGCTTCCAATCCAGTCTCGGCCGCTGGGTCGATAAGCTTTCCGTCCAGTCC
CAATACAAGACGATCCCGACTTTCCTGACCCTCATCATCTTCGGCTTCCTGTATGAACTGGTCGTCGTCTGGGAT
GCGTTGCGCATGAAGAACACCATTCAGGTCATTGGCGTCTGCATCGCTAATCTGGCCTTGCTCGTCTACACCGCC
ATCCAGGTCGACCAGATCCAGATGGCCATCAACACCCTCGGCGCCGAGGCCCTTAAACCCGGCATCACTCCCGAA
GAGGTCTGGGCCAACGTCAGGCCCTTCCTTGTCGCCATCCCGGCCATCATTGCCCTGGCCACCGCCGCCATGGTC
TTTATCGCCTGGAAGCTCTACCAGGAGTTCGCCTGGGATATCCTCAAAAACATTGGCGCTGACTATCGCATGAAG
AAGCGTTTCCTCCATTACCAGATTTACATCGCACTGCTCAAGTTCGACTTCTTCTTCTTCCTCGGCTTCATCATC
CAGTTCGTCGTCATCGTCGCCCAAAAGACGGATCCCGAGTTCGCCCTGACCATCGCCACCATCCCCATCACCATC
TGCATTCTCCTCGCCGCTGCCTACTTCACCCGCCGCGAGAATAAGCTGGGCATGATGGCTGTCATAATCCTCTAC
CTGGGCGGACTCATATACTTCATCTTCAAGCTCGTCCGCATCTACCAGCCCGAATACAGGCTCTTCTACTTGCCC
GTGCGCAAATCTCTCACCGCCTTCGCCGTCATCACCATCCTATTGATTCTACTCACCATTGCAAACGCCATCATC
TGCATGCGCAACTTCGACAAGGGCCTCAAGGCCCACTTGCTGTCCCCGCGCCGAATGGACGAGAAGCCCGACGCT
CATTCCATCAGCCTGCACGACGTCAAGCCGCAAATTCCCAGTCGGATGACCATCGACTGA
Gene >Ophio5|1703
ATGCCTAGGGTTTAGATACGTTACCTCGCACCGTGCTCCGTACAACATCATCACGCGCCCGTTCCGCTTCTCCTG
AGCCACCCCTTCTCTAGTCCTCCTCCTCCGCTTCCTATTCCTATACTCACCATCTCCTTTCACCTTTGCTTCACC
TTGATCCCTCTCCTCATCCGACCTCTTCCTCCAGTCTCTCGTTCAGTAGCAGCCTCGGCATTTACCGTTCCTCTA
ATTCCTCCCTGCCTTCGCGCCGCGTCTTCGCCACCGAGCCATCATCAACAGGAGAAAGCAGACCGTCCCTAAAAA
TAAACCAGCACCAAAGAAGAAGCAAAAAAAGAAAAGGCGCAACCACGCCCTTTCACCCTTCCGTCTTCCCCTCTC
TCGCCCTGCGTGCGGATACTTCTTCCTCATCGACGACGACGACGACAACTCTCCGTTGACTCCCGGTCGGAGTCG
CCCAGTCGCCCGTCCTGGCTACCAGGTTAGAGACTTGAGCCACCCCTCCCCTCTCCCTCTCCTTCGCCCAGCCGC
CAATCAATTGCTCACATCTCAGCGCTCGTCACAGGCCCTCCTCGTTCGACCAAAACTCAAAGTACTCGCGCGAAT
TCGGCCAGGCTTATCCTCAGCCCGCATACTCACAGCCCGCCTACGCGGAGAATGCGAATCTAAACGCTGGCTTCG
ACCAGGGCTACGCCTATCGCCAAGGCTTCGCCCCTTCCACACCGGCGAGGAGCGTCTATCGCGACAGGATGAGCT
TCCTCAAGTCCAAATGGCCCGCCGCCTTCATGGCTGTCACCAGCCTCCAGGCCATTGTCTGCTTGGCATTCGAGT
CGTACGTCCCGCCGCCGCCGCATTCGACGCCCGCTTACCATTTGTCCCCTCTTAGATTCGTCTTTGCGCGCTTCC
AATCCAGTCTCGGCCGCTGGGTCGATAAGCTTTCCGTCCAGTCCCAATACAAGACGATCCCGACTTTCCTGACCC
TCATCATCTTCGGCTTCCTGTATGAACTGGTCGTCGTCTGGGATGCGTTGCGCATGAAGAACACCATTCAGGTCA
TTGGCGTCTGCATCGCTAATCTGGCCTTGCTCGTCTACACCGCCATCCAGGTCGACCAGATCCAGATGGCCATCA
ACACCCTCGGCGCCGAGGCCCTTAAACCCGGCATCACTCCCGAAGAGGTCTGGGCCAACGTCAGGCCCTTCCTTG
TCGCCATCCCGGCCATCATTGCCCTGGCCACCGCCGCCATGGTCTTTATCGCCTGGAAGCTCTACCAGGAGTTCG
CCTGGGATATCCTCAAAAACATTGGCGCTGACTATCGCATGAAGAAGCGTTTCCTCCATTACCAGGTCCGTGGCA
CATACGAGCGCCTGTCGCTGCCAAGACGCTAATATCTCCTCCCCCCCTTTCAGATTTACATCGCACTGCTCAAGT
TCGACTTCTTCTTCTTCCTCGGCTTCATCATCCAGTTCGTCGTCATCGTCGCCCAAAAGACGGATCCCGAGTTCG
CCCTGACCATCGCCACCATCCCCATCACCATCTGCATTCTCCTCGCCGCTGCCTACTTCACCCGCCGCGAGAATA
AGCTGGGCATGATGGCTGTCATAATCCTCTACCTGGGCGGACTCATATACTTCATCTTCAAGCTCGTCCGCATCT
ACCAGCCCGAATACAGGCTCTTCTACTTGCCCGTGCGCAAATCTCTCACCGCCTTCGCCGTCATCACCATCCTAT
TGATTCTACTCACCATTGCAAACGCCATCATCTGCATGCGCAACTTCGACAAGGGCCTCAAGGCCCACTTGCTGT
CCCCGCGCCGAATGGACGAGAAGCCCGACGCTCATTCCATCAGCCTGCACGACGTCAAGCCGCAAATTCCCAGTC
GGATGACCATCGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail