Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1697
Gene name
Locationscaffold_162:34329..35750
Strand-
Gene length (bp)1421
Transcript length (bp)1311
Coding sequence length (bp)1308
Protein length (aa) 436

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03403 PAF-AH_p_II Platelet-activating factor acetylhydrolase, isoform II 7.9E-11 107 215
PF03403 PAF-AH_p_II Platelet-activating factor acetylhydrolase, isoform II 2.5E-06 268 376
PF12740 Chlorophyllase2 Chlorophyllase enzyme 3.2E-07 176 300

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AZY1|A1751_ARTBC Probable 1-alkyl-2-acetylglycerophosphocholine esterase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01751 PE=1 SV=1 45 422 5.0E-40

GO

GO Term Description Terminal node
GO:0016042 lipid catabolic process Yes
GO:0003847 1-alkyl-2-acetylglycerophosphocholine esterase activity Yes
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0009056 catabolic process No
GO:0006629 lipid metabolic process No
GO:0052689 carboxylic ester hydrolase activity No
GO:0003824 catalytic activity No
GO:1901575 organic substance catabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 53 75 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1697
MTLLLALAAARLTCPLRRPRRGGGASFSLSDAGPPQGGELSTHRLISKTMLPILVFVGALVAVGTAVLIPGPIGA
FSVAMRTHELTDSNRRDPYSPYNSSSRRRILVSVFLPLDPVRHADARVQQLPYMPPLTAEEYGKQAAAIAPALKD
VFSLLSIEYRRLETTAHPCGDYVGKTSSYPVVIFSPGLSGSRMMYAAGARDLASQGYVVITIDHPYDASIVEFPD
GTVIRGINITTPADILHAVMVRAADVTFLINQLHDNVGLEHLTAGFSGVVDVEKMAIYGHSLGGATAAEVMLKDN
RLLGGMNWDGQMQGDSANEGLVRPFVQLGVPGHRHMNGSNWAAFYRLLRGPKLELEVAGTTHSSFTDLPLLLSTT
VVPPAYRPAVEQVLGTVNGRLLRRTLTGILKASLDFVFGKDAEGVERLTDDYFGVSVVEDR
Coding >Ophio5|1697
ATGACACTGCTTCTCGCCCTTGCTGCTGCCCGTCTTACCTGTCCTCTTCGACGGCCGCGACGGGGCGGAGGCGCA
TCCTTCAGCTTGTCTGATGCGGGCCCCCCCCAAGGTGGCGAATTATCAACGCATCGACTCATTAGCAAGACGATG
CTTCCGATTCTGGTTTTTGTCGGTGCCCTCGTGGCTGTTGGGACGGCCGTTTTGATCCCCGGCCCAATTGGGGCA
TTTTCAGTGGCGATGCGAACTCATGAACTCACGGACAGCAATCGCCGCGATCCCTACTCTCCTTACAATAGCTCG
AGTCGAAGGCGCATCCTCGTCTCTGTCTTTCTGCCGCTGGATCCGGTCCGGCACGCGGATGCTAGGGTCCAGCAG
CTACCTTATATGCCGCCTCTCACGGCGGAAGAGTATGGCAAGCAGGCGGCGGCGATTGCTCCCGCTCTCAAAGAT
GTCTTCTCGCTCCTGAGCATCGAATATCGCCGGCTGGAAACGACCGCACATCCCTGTGGAGACTACGTAGGGAAA
ACCAGTAGCTACCCGGTCGTCATCTTCTCGCCTGGACTAAGCGGGTCGCGGATGATGTATGCTGCTGGCGCAAGG
GACCTGGCCAGTCAGGGCTACGTCGTCATCACCATCGATCATCCGTATGACGCGTCCATTGTCGAGTTTCCGGAC
GGCACCGTCATCCGCGGCATCAATATCACGACCCCGGCTGACATTTTGCATGCTGTCATGGTCCGGGCGGCAGAC
GTCACGTTCCTCATCAACCAGCTGCACGATAACGTGGGACTGGAGCATCTGACAGCAGGCTTCTCCGGCGTCGTC
GACGTGGAAAAGATGGCCATCTACGGCCACTCGCTCGGCGGCGCCACGGCAGCCGAAGTCATGTTAAAGGACAAT
CGGCTGCTCGGCGGCATGAACTGGGACGGCCAAATGCAAGGCGATTCAGCCAACGAAGGCCTCGTCCGACCATTC
GTCCAGCTGGGCGTCCCGGGCCATCGACACATGAATGGCTCCAACTGGGCCGCCTTTTACCGGCTGCTGCGCGGG
CCCAAGCTGGAGCTGGAAGTGGCCGGGACGACACACTCCTCGTTTACCGACTTGCCGCTGCTGTTGTCGACGACG
GTCGTTCCGCCGGCGTATCGGCCGGCGGTGGAACAGGTGCTGGGAACGGTCAACGGACGTCTGCTGAGACGGACC
TTGACGGGGATTCTGAAGGCCTCGTTGGACTTTGTCTTTGGGAAGGACGCTGAGGGGGTGGAGAGGTTGACTGAC
GATTATTTCGGTGTGTCGGTTGTAGAGGATAGA
Transcript >Ophio5|1697
ATGACACTGCTTCTCGCCCTTGCTGCTGCCCGTCTTACCTGTCCTCTTCGACGGCCGCGACGGGGCGGAGGCGCA
TCCTTCAGCTTGTCTGATGCGGGCCCCCCCCAAGGTGGCGAATTATCAACGCATCGACTCATTAGCAAGACGATG
CTTCCGATTCTGGTTTTTGTCGGTGCCCTCGTGGCTGTTGGGACGGCCGTTTTGATCCCCGGCCCAATTGGGGCA
TTTTCAGTGGCGATGCGAACTCATGAACTCACGGACAGCAATCGCCGCGATCCCTACTCTCCTTACAATAGCTCG
AGTCGAAGGCGCATCCTCGTCTCTGTCTTTCTGCCGCTGGATCCGGTCCGGCACGCGGATGCTAGGGTCCAGCAG
CTACCTTATATGCCGCCTCTCACGGCGGAAGAGTATGGCAAGCAGGCGGCGGCGATTGCTCCCGCTCTCAAAGAT
GTCTTCTCGCTCCTGAGCATCGAATATCGCCGGCTGGAAACGACCGCACATCCCTGTGGAGACTACGTAGGGAAA
ACCAGTAGCTACCCGGTCGTCATCTTCTCGCCTGGACTAAGCGGGTCGCGGATGATGTATGCTGCTGGCGCAAGG
GACCTGGCCAGTCAGGGCTACGTCGTCATCACCATCGATCATCCGTATGACGCGTCCATTGTCGAGTTTCCGGAC
GGCACCGTCATCCGCGGCATCAATATCACGACCCCGGCTGACATTTTGCATGCTGTCATGGTCCGGGCGGCAGAC
GTCACGTTCCTCATCAACCAGCTGCACGATAACGTGGGACTGGAGCATCTGACAGCAGGCTTCTCCGGCGTCGTC
GACGTGGAAAAGATGGCCATCTACGGCCACTCGCTCGGCGGCGCCACGGCAGCCGAAGTCATGTTAAAGGACAAT
CGGCTGCTCGGCGGCATGAACTGGGACGGCCAAATGCAAGGCGATTCAGCCAACGAAGGCCTCGTCCGACCATTC
GTCCAGCTGGGCGTCCCGGGCCATCGACACATGAATGGCTCCAACTGGGCCGCCTTTTACCGGCTGCTGCGCGGG
CCCAAGCTGGAGCTGGAAGTGGCCGGGACGACACACTCCTCGTTTACCGACTTGCCGCTGCTGTTGTCGACGACG
GTCGTTCCGCCGGCGTATCGGCCGGCGGTGGAACAGGTGCTGGGAACGGTCAACGGACGTCTGCTGAGACGGACC
TTGACGGGGATTCTGAAGGCCTCGTTGGACTTTGTCTTTGGGAAGGACGCTGAGGGGGTGGAGAGGTTGACTGAC
GATTATTTCGGTGTGTCGGTTGTAGAGGATAGATAG
Gene >Ophio5|1697
ATGACACTGCTTCTCGCCCTTGCTGCTGCCCGTCTTACCTGTCCTCTTCGACGGCCGCGACGGGGCGGAGGCGCA
TCCTTCAGCTTGTCTGATGCGGGCCCCCCGTAAGCAAGCTTGCGCTCCGGGTCAGCAAAGTGTCATGTATAAAAA
CCCCCGCGCCGTAGCCAAGGTGGCGAATTATCAACGCATCGACTCATTAGCAAGACGATGCTTCCGATTCTGGTT
TTTGTCGGTGCCCTCGTGGCTGTTGGGACGGCCGTTTTGATCCCCGGCCCAATTGGGGCATTTTCAGTGGCGATG
CGAACTCATGAACTCACGGACAGCAATCGCCGCGATCCCTACTCTCCTTACAATAGCTCGAGTCGAAGGCGCATC
CTCGTCTCTGTCTTTCTGCCGCTGGATCCGGTCCGGCACGCGGATGCTAGGGTCCAGCAGCTACCTTATATGCCG
CCTCTCACGGCGGAAGAGTATGGCAAGCAGGCGGCGGCGATTGCTCCCGCTCTCAAAGATGTCTTCTCGCTCCTG
AGCATCGAATATCGCCGGCTGGAAACGACCGCACATCCCTGTGGAGACTACGTAGGGAAAACCAGTAGCTACCCG
GTCGTCATCTTCTCGCCTGGACTAAGCGGGTCGCGGATGATGTATGCTGCTGGCGCAAGGGACCTGGCCAGTCAG
GGCTACGTCGTCATCACCATCGATCATCCGTATGACGCGTCCATTGTCGAGTTTCCGGACGGCACCGTCATCCGC
GGCATCAATATCACGACCCCGGCTGACATTTTGCATGCTGTCATGGTGGGTGTCTCAACGACGTTACCGACTGAC
CATGGCTGACAACAGAGTAGGTCCGGGCGGCAGACGTCACGTTCCTCATCAACCAGCTGCACGATAACGTGGGAC
TGGAGCATCTGACAGCAGGCTTCTCCGGCGTCGTCGACGTGGAAAAGATGGCCATCTACGGCCACTCGCTCGGCG
GCGCCACGGCAGCCGAAGTCATGTTAAAGGACAATCGGCTGCTCGGCGGCATGAACTGGGACGGCCAAATGCAAG
GCGATTCAGCCAACGAAGGCCTCGTCCGACCATTCGTCCAGCTGGGCGTCCCGGGCCATCGACACATGAATGGCT
CCAACTGGGCCGCCTTTTACCGGCTGCTGCGCGGGCCCAAGCTGGAGCTGGAAGTGGCCGGGACGACACACTCCT
CGTTTACCGACTTGCCGCTGCTGTTGTCGACGACGGTCGTTCCGCCGGCGTATCGGCCGGCGGTGGAACAGGTGC
TGGGAACGGTCAACGGACGTCTGCTGAGACGGACCTTGACGGGGATTCTGAAGGCCTCGTTGGACTTTGTCTTTG
GGAAGGACGCTGAGGGGGTGGAGAGGTTGACTGACGATTATTTCGGTGTGTCGGTTGTAGAGGATAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail