Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1694
Gene name
Locationscaffold_162:26629..29667
Strand-
Gene length (bp)3038
Transcript length (bp)2889
Coding sequence length (bp)2886
Protein length (aa) 962

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 4.0E-76 386 670
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 1.1E-39 32 182
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 4.7E-38 206 375

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 18 778 6.0E-133
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 36 667 1.0E-36
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 84 708 1.0E-30
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 28 694 3.0E-29
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 42 705 1.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 18 778 6.0E-133
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 36 667 1.0E-36
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 84 708 1.0E-30
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 28 694 3.0E-29
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 42 705 1.0E-28
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 25 750 6.0E-28
sp|Q9C8G5|CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana GN=ERD4 PE=2 SV=1 30 728 4.0E-27
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 42 676 4.0E-27
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 53 742 4.0E-27
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 33 708 1.0E-26
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 38 744 2.0E-26
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 25 667 2.0E-26
sp|Q8GUH7|CSCLC_ARATH CSC1-like protein HYP1 OS=Arabidopsis thaliana GN=HYP1 PE=2 SV=1 30 742 4.0E-26
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 83 742 1.0E-24
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 53 704 2.0E-23
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 28 631 2.0E-22
sp|Q9FVQ5|CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana GN=At1g32090 PE=1 SV=1 27 725 2.0E-20
sp|Q94A87|CSCL9_ARATH CSC1-like protein At1g10090 OS=Arabidopsis thaliana GN=At1g10090 PE=1 SV=1 27 667 3.0E-19
sp|F4I248|CSCLB_ARATH CSC1-like protein At1g69450 OS=Arabidopsis thaliana GN=At1g69450 PE=2 SV=1 30 702 5.0E-18
sp|F4IBD7|CSCLA_ARATH CSC1-like protein RXW8 OS=Arabidopsis thaliana GN=RXW8 PE=2 SV=1 27 667 4.0E-17
sp|Q91YT8|CSCL1_MOUSE CSC1-like protein 1 OS=Mus musculus GN=Tmem63a PE=1 SV=1 84 638 9.0E-17
sp|Q5R826|CSCL1_PONAB CSC1-like protein 1 OS=Pongo abelii GN=TMEM63A PE=2 SV=1 84 672 4.0E-15
sp|O94886|CSCL1_HUMAN CSC1-like protein 1 OS=Homo sapiens GN=TMEM63A PE=1 SV=3 84 662 1.0E-13
sp|Q8CBX0|CSC1_MOUSE Calcium permeable stress-gated cation channel 1 OS=Mus musculus GN=Tmem63c PE=1 SV=1 34 653 4.0E-13
sp|F4JCY2|CSCL8_ARATH CSC1-like protein At3g54510 OS=Arabidopsis thaliana GN=At3g54510 PE=2 SV=1 31 719 7.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 31 53 22
2 117 134 17
3 162 184 22
4 391 413 22
5 433 455 22
6 486 508 22
7 598 620 22
8 650 672 22
9 676 698 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1694
MDLPLFARDDAGKELLDLLKNPFQGQLAAASLLSALGISLGFTAFIAICFSFLRPYNQAIYAPKLKHADEKHAPP
PIGKKPWSWVTPLMRTTEASLVQQIGMDATIFLRFIRMCRNLFLVLALVGMAILVPVNVTNSVKEYQGHRTEWIM
QITPRDVFGRPQWVQVIVAWIFNLVIIAFLWTNYRSVLQLRRQYFETDDYQNSLHSRTLMLYDLPRQARSDEGIA
RIIDKVVPNSSFARTAVARNVKILPELIDEHAHAVRKLEKILARYLRNPAQLPASRPTCKPSKKDRSFDTYPRKQ
KLDAIDYYTQRIRDLEIEIKEVRASVDRRGTMPYGFASYSDMAEAHSIAHACHRTKPEGATVTLAPPPSDIIWQN
MSLSSASRRRRRWINNFWIVVLTLLWVGPNAMIAIFLVSLANLGKVWPAFQRSLSESTVFWGMVQGIASPALMSL
VYLVLPIIFRRLSIQAGDQTKTGRERHVLAKMYSFFVFNNLIVFSFFSTIWAFVAGVLDKTSRGANAWDAIQKQD
IAAGVFLAFCDNSPFWVTYLLQRQLGAAIDLAQIWPLIQAFFLKKLSSPTPRELIELTAPPPFDYASYFNYFLFY
STVTLCFAGIQPLVLLATALYFCIDSYLKKYLLLYRFVTKTESGGLFWRVLFNRFVLATILSNLVVLLTCWVRGD
GTHIQFYAATPLPLVMVAFKLYCRRAFDSKIRYYSTRLSAKLHDPALQKEPRARSEKLSTRFGHPALYKPLITPM
VHSKAQNLLPSVYRGRLTDGREAGGAGDLVSVSGYSDMYALDAMQQGGKPGKSASNLPGFEYVSESHMDFAYYKN
RAEFTEQHGGSELYGRPATPGSVDDSETRSVSGRSFAATPPPQQQQQRRVPTMTTTKTTTTTTTTPSEATYRNRS
PLYALENNSSAGLVRNAAALPTGPTVSGPFGYSGLAQNDEDPSQYSYFRGGGRPVRPAGEGW
Coding >Ophio5|1694
ATGGACTTGCCCCTCTTCGCCCGCGATGACGCCGGCAAGGAACTGCTGGACCTACTCAAGAATCCCTTCCAGGGA
CAGCTCGCCGCCGCTTCCCTCTTGTCTGCCCTGGGCATCTCGCTCGGCTTCACTGCCTTCATCGCCATATGCTTC
TCCTTCCTCCGTCCATATAACCAGGCCATCTACGCCCCCAAGCTCAAACACGCCGATGAGAAGCACGCGCCGCCC
CCCATCGGCAAGAAGCCCTGGTCCTGGGTTACGCCGCTGATGCGCACCACCGAGGCGTCTCTGGTGCAGCAGATT
GGCATGGACGCAACCATCTTTTTGCGTTTCATCCGCATGTGTCGCAACTTGTTTCTCGTCCTCGCCCTCGTCGGC
ATGGCCATCCTCGTGCCTGTCAACGTGACCAACTCCGTCAAAGAGTATCAGGGCCATCGCACCGAGTGGATTATG
CAAATTACGCCTCGCGACGTCTTTGGCCGACCGCAGTGGGTACAGGTCATCGTCGCCTGGATCTTTAACCTCGTC
ATCATTGCCTTTTTATGGACCAACTATCGGAGTGTGTTGCAGCTGCGTCGCCAGTACTTTGAGACAGATGACTAC
CAGAATAGCCTGCACTCAAGGACACTCATGCTCTATGATCTCCCTCGCCAGGCCCGCTCCGACGAGGGCATCGCC
CGCATCATCGACAAGGTGGTGCCCAACTCGTCATTTGCCCGCACCGCCGTCGCCCGCAACGTCAAGATCCTGCCC
GAGCTCATCGACGAGCACGCCCATGCTGTCCGCAAGCTCGAGAAGATACTGGCCAGATACCTGCGTAACCCGGCT
CAGCTCCCGGCCTCGCGCCCGACGTGCAAGCCGTCAAAAAAGGACCGCTCCTTCGACACGTACCCGCGCAAGCAG
AAGCTCGATGCCATCGACTACTACACGCAGCGGATCCGCGACCTCGAGATCGAGATCAAGGAGGTGCGCGCAAGC
GTTGATCGTCGCGGCACCATGCCTTACGGCTTCGCCAGCTACTCGGACATGGCCGAGGCGCACAGCATCGCCCAC
GCCTGCCATCGGACCAAGCCCGAGGGCGCGACGGTGACTCTGGCGCCGCCGCCGTCGGATATCATCTGGCAAAAC
ATGTCGCTGTCGAGCGCGTCGCGCCGCCGCCGGCGTTGGATCAACAACTTCTGGATCGTGGTGCTGACGCTGCTT
TGGGTCGGCCCCAACGCCATGATTGCCATCTTCCTCGTCAGTCTGGCCAACCTCGGCAAGGTCTGGCCCGCCTTT
CAGCGCTCGCTCTCGGAGAGCACCGTCTTTTGGGGCATGGTGCAGGGTATCGCGTCGCCGGCGCTCATGTCTCTC
GTCTATCTCGTCTTGCCCATCATCTTCCGTCGGCTGTCCATCCAGGCCGGCGACCAGACCAAGACGGGCCGCGAG
AGGCACGTCCTGGCCAAGATGTACTCGTTCTTCGTCTTCAACAACCTCATCGTCTTTTCCTTCTTCAGCACCATC
TGGGCCTTTGTCGCCGGCGTGCTGGACAAGACGAGCCGTGGGGCCAACGCGTGGGATGCCATTCAGAAGCAAGAT
ATTGCCGCCGGCGTCTTCTTGGCCTTTTGCGACAACAGCCCGTTTTGGGTCACGTACCTGTTACAGCGGCAGCTG
GGCGCGGCCATTGACTTGGCCCAGATCTGGCCGCTGATCCAGGCCTTCTTCCTCAAGAAACTGTCGAGCCCGACG
CCGCGAGAGCTGATTGAGCTGACGGCGCCGCCGCCTTTCGACTACGCCAGCTACTTCAACTACTTCCTCTTCTAC
TCGACGGTGACGCTGTGCTTTGCGGGCATCCAGCCGCTGGTGCTGCTGGCGACGGCGCTGTACTTTTGCATCGAC
TCTTACCTCAAGAAGTACCTGCTCCTCTACCGGTTCGTGACCAAGACGGAGTCGGGCGGCCTGTTTTGGCGCGTG
CTCTTCAACCGCTTCGTGCTGGCGACGATACTCTCGAACCTGGTGGTGCTTCTGACTTGCTGGGTGCGCGGTGAC
GGTACGCACATTCAGTTCTACGCCGCGACGCCGCTTCCGCTCGTCATGGTGGCCTTTAAGCTGTACTGCCGGCGG
GCGTTTGACAGCAAGATCCGCTACTACAGCACCCGGCTGAGCGCCAAGCTGCACGACCCGGCGCTGCAAAAGGAG
CCTCGGGCGCGGAGCGAGAAGCTGTCGACTCGGTTCGGGCATCCGGCGCTGTACAAGCCGCTCATCACGCCCATG
GTACACTCCAAGGCGCAGAACCTGCTGCCGTCGGTGTATCGCGGCCGGCTGACGGACGGGCGAGAGGCCGGAGGG
GCCGGCGACCTGGTCAGCGTCAGCGGCTACTCGGACATGTACGCCCTCGACGCCATGCAACAAGGGGGGAAGCCG
GGCAAGAGTGCGAGCAACCTGCCGGGCTTCGAGTACGTGTCGGAGTCGCACATGGACTTTGCCTACTACAAGAAC
CGGGCCGAGTTTACCGAGCAACACGGCGGAAGCGAGCTCTACGGGAGGCCCGCGACGCCGGGCTCCGTCGACGAC
TCGGAGACGCGGTCCGTGTCGGGCCGGTCCTTTGCGGCAACGCCCCCGCCGCAACAGCAACAGCAGCGAAGGGTG
CCGACGATGACGACGACGAAGACGACGACGACGACGACGACGACGCCGTCAGAAGCGACGTACCGCAACCGCAGC
CCGCTCTACGCGCTGGAGAACAACAGCTCGGCGGGCCTCGTGCGTAACGCGGCGGCCTTGCCGACGGGACCGACG
GTGAGCGGTCCGTTTGGATATAGCGGGCTGGCGCAGAACGACGAGGATCCAAGTCAGTACAGCTACTTCCGCGGA
GGGGGCAGGCCGGTTCGGCCAGCGGGAGAGGGATGG
Transcript >Ophio5|1694
ATGGACTTGCCCCTCTTCGCCCGCGATGACGCCGGCAAGGAACTGCTGGACCTACTCAAGAATCCCTTCCAGGGA
CAGCTCGCCGCCGCTTCCCTCTTGTCTGCCCTGGGCATCTCGCTCGGCTTCACTGCCTTCATCGCCATATGCTTC
TCCTTCCTCCGTCCATATAACCAGGCCATCTACGCCCCCAAGCTCAAACACGCCGATGAGAAGCACGCGCCGCCC
CCCATCGGCAAGAAGCCCTGGTCCTGGGTTACGCCGCTGATGCGCACCACCGAGGCGTCTCTGGTGCAGCAGATT
GGCATGGACGCAACCATCTTTTTGCGTTTCATCCGCATGTGTCGCAACTTGTTTCTCGTCCTCGCCCTCGTCGGC
ATGGCCATCCTCGTGCCTGTCAACGTGACCAACTCCGTCAAAGAGTATCAGGGCCATCGCACCGAGTGGATTATG
CAAATTACGCCTCGCGACGTCTTTGGCCGACCGCAGTGGGTACAGGTCATCGTCGCCTGGATCTTTAACCTCGTC
ATCATTGCCTTTTTATGGACCAACTATCGGAGTGTGTTGCAGCTGCGTCGCCAGTACTTTGAGACAGATGACTAC
CAGAATAGCCTGCACTCAAGGACACTCATGCTCTATGATCTCCCTCGCCAGGCCCGCTCCGACGAGGGCATCGCC
CGCATCATCGACAAGGTGGTGCCCAACTCGTCATTTGCCCGCACCGCCGTCGCCCGCAACGTCAAGATCCTGCCC
GAGCTCATCGACGAGCACGCCCATGCTGTCCGCAAGCTCGAGAAGATACTGGCCAGATACCTGCGTAACCCGGCT
CAGCTCCCGGCCTCGCGCCCGACGTGCAAGCCGTCAAAAAAGGACCGCTCCTTCGACACGTACCCGCGCAAGCAG
AAGCTCGATGCCATCGACTACTACACGCAGCGGATCCGCGACCTCGAGATCGAGATCAAGGAGGTGCGCGCAAGC
GTTGATCGTCGCGGCACCATGCCTTACGGCTTCGCCAGCTACTCGGACATGGCCGAGGCGCACAGCATCGCCCAC
GCCTGCCATCGGACCAAGCCCGAGGGCGCGACGGTGACTCTGGCGCCGCCGCCGTCGGATATCATCTGGCAAAAC
ATGTCGCTGTCGAGCGCGTCGCGCCGCCGCCGGCGTTGGATCAACAACTTCTGGATCGTGGTGCTGACGCTGCTT
TGGGTCGGCCCCAACGCCATGATTGCCATCTTCCTCGTCAGTCTGGCCAACCTCGGCAAGGTCTGGCCCGCCTTT
CAGCGCTCGCTCTCGGAGAGCACCGTCTTTTGGGGCATGGTGCAGGGTATCGCGTCGCCGGCGCTCATGTCTCTC
GTCTATCTCGTCTTGCCCATCATCTTCCGTCGGCTGTCCATCCAGGCCGGCGACCAGACCAAGACGGGCCGCGAG
AGGCACGTCCTGGCCAAGATGTACTCGTTCTTCGTCTTCAACAACCTCATCGTCTTTTCCTTCTTCAGCACCATC
TGGGCCTTTGTCGCCGGCGTGCTGGACAAGACGAGCCGTGGGGCCAACGCGTGGGATGCCATTCAGAAGCAAGAT
ATTGCCGCCGGCGTCTTCTTGGCCTTTTGCGACAACAGCCCGTTTTGGGTCACGTACCTGTTACAGCGGCAGCTG
GGCGCGGCCATTGACTTGGCCCAGATCTGGCCGCTGATCCAGGCCTTCTTCCTCAAGAAACTGTCGAGCCCGACG
CCGCGAGAGCTGATTGAGCTGACGGCGCCGCCGCCTTTCGACTACGCCAGCTACTTCAACTACTTCCTCTTCTAC
TCGACGGTGACGCTGTGCTTTGCGGGCATCCAGCCGCTGGTGCTGCTGGCGACGGCGCTGTACTTTTGCATCGAC
TCTTACCTCAAGAAGTACCTGCTCCTCTACCGGTTCGTGACCAAGACGGAGTCGGGCGGCCTGTTTTGGCGCGTG
CTCTTCAACCGCTTCGTGCTGGCGACGATACTCTCGAACCTGGTGGTGCTTCTGACTTGCTGGGTGCGCGGTGAC
GGTACGCACATTCAGTTCTACGCCGCGACGCCGCTTCCGCTCGTCATGGTGGCCTTTAAGCTGTACTGCCGGCGG
GCGTTTGACAGCAAGATCCGCTACTACAGCACCCGGCTGAGCGCCAAGCTGCACGACCCGGCGCTGCAAAAGGAG
CCTCGGGCGCGGAGCGAGAAGCTGTCGACTCGGTTCGGGCATCCGGCGCTGTACAAGCCGCTCATCACGCCCATG
GTACACTCCAAGGCGCAGAACCTGCTGCCGTCGGTGTATCGCGGCCGGCTGACGGACGGGCGAGAGGCCGGAGGG
GCCGGCGACCTGGTCAGCGTCAGCGGCTACTCGGACATGTACGCCCTCGACGCCATGCAACAAGGGGGGAAGCCG
GGCAAGAGTGCGAGCAACCTGCCGGGCTTCGAGTACGTGTCGGAGTCGCACATGGACTTTGCCTACTACAAGAAC
CGGGCCGAGTTTACCGAGCAACACGGCGGAAGCGAGCTCTACGGGAGGCCCGCGACGCCGGGCTCCGTCGACGAC
TCGGAGACGCGGTCCGTGTCGGGCCGGTCCTTTGCGGCAACGCCCCCGCCGCAACAGCAACAGCAGCGAAGGGTG
CCGACGATGACGACGACGAAGACGACGACGACGACGACGACGACGCCGTCAGAAGCGACGTACCGCAACCGCAGC
CCGCTCTACGCGCTGGAGAACAACAGCTCGGCGGGCCTCGTGCGTAACGCGGCGGCCTTGCCGACGGGACCGACG
GTGAGCGGTCCGTTTGGATATAGCGGGCTGGCGCAGAACGACGAGGATCCAAGTCAGTACAGCTACTTCCGCGGA
GGGGGCAGGCCGGTTCGGCCAGCGGGAGAGGGATGGTGA
Gene >Ophio5|1694
ATGGACTTGCCCCTCTTCGCCCGCGATGACGCCGGCAAGGAACTGCTGGACCTACTCAAGAATCCCTTCCAGGGA
CAGGTGAGCCTCTTTCTTTCTGTGACACTTGTTCTATCATGTCTGACGTTTTCGCCTTTCCACCACCTCCCACCC
AGCTCGCCGCCGCTTCCCTCTTGTCTGCCCTGGGCATCTCGCTCGGCTTCACTGCCTTCATCGCCATATGCTTCT
CCTTCCTCCGTCCATATAACCAGGCCATCTACGCCCCCAAGCTCAAACACGCCGATGAGAAGCACGCGCCGCCCC
CCATCGGCAAGAAGCCCTGGTCCTGGGTTACGCCGCTGATGCGCACCACCGAGGCGTCTCTGGTGCAGCAGATTG
GCATGGACGCAACCATCTTTTTGCGTTTCATCCGCATGTGTCGCAACTTGTTTCTCGTCCTCGCCCTCGTCGGCA
TGGCCATCCTCGTGCCTGTCAACGTGACCAACTCCGTCAAAGAGTATCAGGGCCATCGCACCGAGTGGATTATGC
AAATTACGCCTCGCGACGTCTTTGGCCGACCGCAGTGGGTACAGGTCATCGTCGCCTGGATCTTTAACCTCGTCA
TCATTGCCTTTTTATGGACCAACTATCGGAGTGTGTTGCAGCTGCGTCGCCAGTACTTTGAGACAGATGACTACC
AGAATAGCCTGCACTCAAGGACACTCATGGTGAGCGCCAATGCCACTGACTTCTCCCCCTTCTCTTCTCCAGCTA
CCCAACTGACATCCCCTCCCCCCCCTCAGCTCTATGATCTCCCTCGCCAGGCCCGCTCCGACGAGGGCATCGCCC
GCATCATCGACAAGGTGGTGCCCAACTCGTCATTTGCCCGCACCGCCGTCGCCCGCAACGTCAAGATCCTGCCCG
AGCTCATCGACGAGCACGCCCATGCTGTCCGCAAGCTCGAGAAGATACTGGCCAGATACCTGCGTAACCCGGCTC
AGCTCCCGGCCTCGCGCCCGACGTGCAAGCCGTCAAAAAAGGACCGCTCCTTCGACACGTACCCGCGCAAGCAGA
AGCTCGATGCCATCGACTACTACACGCAGCGGATCCGCGACCTCGAGATCGAGATCAAGGAGGTGCGCGCAAGCG
TTGATCGTCGCGGCACCATGCCTTACGGCTTCGCCAGCTACTCGGACATGGCCGAGGCGCACAGCATCGCCCACG
CCTGCCATCGGACCAAGCCCGAGGGCGCGACGGTGACTCTGGCGCCGCCGCCGTCGGATATCATCTGGCAAAACA
TGTCGCTGTCGAGCGCGTCGCGCCGCCGCCGGCGTTGGATCAACAACTTCTGGATCGTGGTGCTGACGCTGCTTT
GGGTCGGCCCCAACGCCATGATTGCCATCTTCCTCGTCAGTCTGGCCAACCTCGGCAAGGTCTGGCCCGCCTTTC
AGCGCTCGCTCTCGGAGAGCACCGTCTTTTGGGGCATGGTGCAGGGTATCGCGTCGCCGGCGCTCATGTCTCTCG
TCTATCTCGTCTTGCCCATCATCTTCCGTCGGCTGTCCATCCAGGCCGGCGACCAGACCAAGACGGGCCGCGAGA
GGCACGTCCTGGCCAAGATGTACTCGTTCTTCGTCTTCAACAACCTCATCGTCTTTTCCTTCTTCAGCACCATCT
GGGCCTTTGTCGCCGGCGTGCTGGACAAGACGAGCCGTGGGGCCAACGCGTGGGATGCCATTCAGAAGCAAGATA
TTGCCGCCGGCGTCTTCTTGGCCTTTTGCGACAACAGCCCGTTTTGGGTCACGTACCTGTTACAGCGGCAGCTGG
GCGCGGCCATTGACTTGGCCCAGATCTGGCCGCTGATCCAGGCCTTCTTCCTCAAGAAACTGTCGAGCCCGACGC
CGCGAGAGCTGATTGAGCTGACGGCGCCGCCGCCTTTCGACTACGCCAGCTACTTCAACTACTTCCTCTTCTACT
CGACGGTGACGCTGTGCTTTGCGGGCATCCAGCCGCTGGTGCTGCTGGCGACGGCGCTGTACTTTTGCATCGACT
CTTACCTCAAGAAGTACCTGCTCCTCTACCGGTTCGTGACCAAGACGGAGTCGGGCGGCCTGTTTTGGCGCGTGC
TCTTCAACCGCTTCGTGCTGGCGACGATACTCTCGAACCTGGTGGTGCTTCTGACTTGCTGGGTGCGCGGTGACG
GTACGCACATTCAGTTCTACGCCGCGACGCCGCTTCCGCTCGTCATGGTGGCCTTTAAGCTGTACTGCCGGCGGG
CGTTTGACAGCAAGATCCGCTACTACAGCACCCGGCTGAGCGCCAAGCTGCACGACCCGGCGCTGCAAAAGGAGC
CTCGGGCGCGGAGCGAGAAGCTGTCGACTCGGTTCGGGCATCCGGCGCTGTACAAGCCGCTCATCACGCCCATGG
TACACTCCAAGGCGCAGAACCTGCTGCCGTCGGTGTATCGCGGCCGGCTGACGGACGGGCGAGAGGCCGGAGGGG
CCGGCGACCTGGTCAGCGTCAGCGGCTACTCGGACATGTACGCCCTCGACGCCATGCAACAAGGGGGGAAGCCGG
GCAAGAGTGCGAGCAACCTGCCGGGCTTCGAGTACGTGTCGGAGTCGCACATGGACTTTGCCTACTACAAGAACC
GGGCCGAGTTTACCGAGCAACACGGCGGAAGCGAGCTCTACGGGAGGCCCGCGACGCCGGGCTCCGTCGACGACT
CGGAGACGCGGTCCGTGTCGGGCCGGTCCTTTGCGGCAACGCCCCCGCCGCAACAGCAACAGCAGCGAAGGGTGC
CGACGATGACGACGACGAAGACGACGACGACGACGACGACGACGCCGTCAGAAGCGACGTACCGCAACCGCAGCC
CGCTCTACGCGCTGGAGAACAACAGCTCGGCGGGCCTCGTGCGTAACGCGGCGGCCTTGCCGACGGGACCGACGG
TGAGCGGTCCGTTTGGATATAGCGGGCTGGCGCAGAACGACGAGGATCCAAGTCAGTACAGCTACTTCCGCGGAG
GGGGCAGGCCGGTTCGGCCAGCGGGAGAGGGATGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail