Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1683
Gene name
Locationscaffold_161:33210..34605
Strand-
Gene length (bp)1395
Transcript length (bp)1113
Coding sequence length (bp)1110
Protein length (aa) 370

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 2.0E-11 36 105

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38739|WSC4_YEAST Cell wall integrity and stress response component 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=WSC4 PE=1 SV=1 32 114 4.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 245 267 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1683
MAAFSTGARRCLSPLLVLLAWPALVLSLDFELCASFNTADSPQNVSIYQTNGLCHDYCMKKSQAYAITQGNSCWC
SNYTPAEETQVDKSKCDRPCPAYPQEFCGGKGVFGYIPLNNMVPAGTKGASQSDEATSTSASSSSAETPTATAWV
TKTVQDTVTPSPRSSSSSRSSVVPRSSAEESSSTDSPPPSPTSSSSSALPTSVVQTVTADGKVQTVTVMPTQSPT
ANATKETTSVRMEQSGLGKGAVVGLVVGIIAAAAATAAMGLYMWMQRKKRREENYMDDPSVRGSSSGILGGRPEM
SGIPGSPESTGNRSSTLQIDPRMDPFKQGLYARSGSHESINTLRDEHDYSRRIQQPKVLRAMNPDPVAED
Coding >Ophio5|1683
ATGGCCGCCTTTTCGACAGGCGCCCGGCGATGCCTCTCGCCGCTACTTGTCTTACTAGCTTGGCCGGCTCTTGTC
CTCAGCTTGGACTTCGAGCTATGCGCCAGCTTCAACACTGCTGATTCTCCGCAGAACGTCAGCATATACCAAACG
AATGGTCTCTGCCACGACTATTGCATGAAGAAGAGCCAAGCCTATGCCATCACTCAAGGAAACTCGTGCTGGTGT
TCCAACTACACGCCTGCCGAAGAAACGCAGGTCGACAAGAGTAAATGCGACCGACCATGCCCGGCCTATCCCCAG
GAGTTTTGCGGCGGCAAGGGCGTCTTCGGCTACATTCCACTCAATAACATGGTGCCTGCGGGCACAAAGGGCGCC
TCCCAGTCTGACGAAGCGACGTCGACATCGGCCAGCTCTTCCTCGGCCGAAACCCCGACGGCGACGGCGTGGGTC
ACCAAGACTGTGCAGGACACAGTGACCCCCTCTCCTCGTTCTTCTTCTTCGTCTCGCTCAAGTGTCGTCCCCCGC
TCTTCGGCCGAAGAGAGCAGCAGCACCGACAGTCCGCCTCCGTCCCCTACGTCCTCGTCCTCATCCGCCCTACCG
ACGTCGGTGGTGCAGACGGTGACGGCCGATGGCAAGGTCCAGACAGTGACCGTCATGCCTACGCAATCGCCCACG
GCCAACGCAACCAAAGAAACGACCAGCGTCCGGATGGAACAGAGCGGCCTCGGAAAGGGCGCCGTCGTCGGTCTC
GTGGTTGGTATAATAGCCGCCGCCGCCGCTACGGCGGCCATGGGCCTCTACATGTGGATGCAGCGCAAGAAGCGT
CGCGAAGAGAACTACATGGACGATCCCAGTGTCCGGGGTAGCTCGTCGGGCATACTGGGCGGCCGTCCCGAGATG
TCGGGCATTCCCGGCTCGCCCGAGTCGACTGGCAACCGAAGCAGCACGTTGCAGATCGACCCGCGCATGGATCCC
TTCAAGCAGGGTCTCTATGCGCGCAGTGGCAGCCATGAGAGCATCAACACGCTGCGGGATGAGCACGACTACTCG
AGGAGAATCCAGCAGCCCAAGGTGCTCCGGGCCATGAACCCCGACCCGGTCGCCGAAGAC
Transcript >Ophio5|1683
ATGGCCGCCTTTTCGACAGGCGCCCGGCGATGCCTCTCGCCGCTACTTGTCTTACTAGCTTGGCCGGCTCTTGTC
CTCAGCTTGGACTTCGAGCTATGCGCCAGCTTCAACACTGCTGATTCTCCGCAGAACGTCAGCATATACCAAACG
AATGGTCTCTGCCACGACTATTGCATGAAGAAGAGCCAAGCCTATGCCATCACTCAAGGAAACTCGTGCTGGTGT
TCCAACTACACGCCTGCCGAAGAAACGCAGGTCGACAAGAGTAAATGCGACCGACCATGCCCGGCCTATCCCCAG
GAGTTTTGCGGCGGCAAGGGCGTCTTCGGCTACATTCCACTCAATAACATGGTGCCTGCGGGCACAAAGGGCGCC
TCCCAGTCTGACGAAGCGACGTCGACATCGGCCAGCTCTTCCTCGGCCGAAACCCCGACGGCGACGGCGTGGGTC
ACCAAGACTGTGCAGGACACAGTGACCCCCTCTCCTCGTTCTTCTTCTTCGTCTCGCTCAAGTGTCGTCCCCCGC
TCTTCGGCCGAAGAGAGCAGCAGCACCGACAGTCCGCCTCCGTCCCCTACGTCCTCGTCCTCATCCGCCCTACCG
ACGTCGGTGGTGCAGACGGTGACGGCCGATGGCAAGGTCCAGACAGTGACCGTCATGCCTACGCAATCGCCCACG
GCCAACGCAACCAAAGAAACGACCAGCGTCCGGATGGAACAGAGCGGCCTCGGAAAGGGCGCCGTCGTCGGTCTC
GTGGTTGGTATAATAGCCGCCGCCGCCGCTACGGCGGCCATGGGCCTCTACATGTGGATGCAGCGCAAGAAGCGT
CGCGAAGAGAACTACATGGACGATCCCAGTGTCCGGGGTAGCTCGTCGGGCATACTGGGCGGCCGTCCCGAGATG
TCGGGCATTCCCGGCTCGCCCGAGTCGACTGGCAACCGAAGCAGCACGTTGCAGATCGACCCGCGCATGGATCCC
TTCAAGCAGGGTCTCTATGCGCGCAGTGGCAGCCATGAGAGCATCAACACGCTGCGGGATGAGCACGACTACTCG
AGGAGAATCCAGCAGCCCAAGGTGCTCCGGGCCATGAACCCCGACCCGGTCGCCGAAGACTGA
Gene >Ophio5|1683
ATGGCCGCCTTTTCGACAGGCGCCCGGCGATGCCTCTCGCCGCTACTTGTCTTACTAGCTTGGCCGGCTCTTGTC
CTCAGCTTGGACTTCGAGCTATGCGCCAGCTTCAACACTGCTGATTCTCCGCAGAGTTCGTAATGTTCCTCTCTT
TCGTCTTTCCTCGCTGACTTTTGACTCTGCAGACGTCAGCATATACCAAACGAATGGTCTCTGCCACGACTATTG
CATGAAGAAGAGCCAAGCCTATGCCATCACTCAAGGAAACTCGTGCTGGTGTTCCAACTACACGCCTGCCGAAGA
AACGCAGGTCGACAAGAGTAAATGCGACCGACCATGCCCGGCCTATCCCCAGGAGTTTTGCGGCGGCAAGGGCGT
CTTCGGCTACATTCCACTCAATAACATGGTGCCTGCGGGCACAAAGGGCGCCTCCCAGTCTGACGAAGCGACGTC
GACATCGGCCAGCTCTTCCTCGGTTAGTCTTTACACTCTCTTCTTCTTCTCTACTCGTGCCCTGTCAGACGACTC
CTCGCCGTCCCCATCGCCGCCGCCACCGCCCAATCTCCTTGATAGCTCCAGACGAGACGACATGGCTTGGCTTAT
CTGTCGCAACTTCAGGCCGAAACCCCGACGGCGACGGCGTGGGTCACCAAGACTGTGCAGGACACAGTGACCCCC
TCTCCTCGTTCTTCTTCTTCGTCTCGCTCAAGTGTCGTCCCCCGCTCTGTATGCTCAAGCCTTTCGCTCGTCTTA
TCTCGTTGCCCGCTGGATGCTCTCGCCTGTCGTCCGCACTCTGGCTAACATGGTCAATAGTCGGCCGAAGAGAGC
AGCAGCACCGACAGTCCGCCTCCGTCCCCTACGTCCTCGTCCTCATCCGCCCTACCGACGTCGGTGGTGCAGACG
GTGACGGCCGATGGCAAGGTCCAGACAGTGACCGTCATGCCTACGCAATCGCCCACGGCCAACGCAACCAAAGAA
ACGACCAGCGTCCGGATGGAACAGAGCGGCCTCGGAAAGGGCGCCGTCGTCGGTCTCGTGGTTGGTATAATAGCC
GCCGCCGCCGCTACGGCGGCCATGGGCCTCTACATGTGGATGCAGCGCAAGAAGCGTCGCGAAGAGAACTACATG
GACGATCCCAGTGTCCGGGGTAGCTCGTCGGGCATACTGGGCGGCCGTCCCGAGATGTCGGGCATTCCCGGCTCG
CCCGAGTCGACTGGCAACCGAAGCAGCACGTTGCAGATCGACCCGCGCATGGATCCCTTCAAGCAGGGTCTCTAT
GCGCGCAGTGGCAGCCATGAGAGCATCAACACGCTGCGGGATGAGCACGACTACTCGAGGAGAATCCAGCAGCCC
AAGGTGCTCCGGGCCATGAACCCCGACCCGGTCGCCGAAGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail