Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1676
Gene name
Locationscaffold_161:12861..15252
Strand-
Gene length (bp)2391
Transcript length (bp)2166
Coding sequence length (bp)2163
Protein length (aa) 721

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 3.6E-44 55 546
PF07690 MFS_1 Major Facilitator Superfamily 1.7E-19 110 489

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 6 553 0.0E+00
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 10 547 2.0E-173
sp|Q494P0|PHT17_ARATH Probable inorganic phosphate transporter 1-7 OS=Arabidopsis thaliana GN=PHT1-7 PE=2 SV=2 38 553 4.0E-95
sp|Q8H6G9|PHT17_ORYSJ Probable inorganic phosphate transporter 1-7 OS=Oryza sativa subsp. japonica GN=PHT1-7 PE=2 SV=1 38 551 9.0E-94
sp|Q8H6H0|PHT16_ORYSJ Inorganic phosphate transporter 1-6 OS=Oryza sativa subsp. japonica GN=PHT1-6 PE=1 SV=1 38 556 1.0E-92
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 6 553 0.0E+00
sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 PE=1 SV=2 10 547 2.0E-173
sp|Q494P0|PHT17_ARATH Probable inorganic phosphate transporter 1-7 OS=Arabidopsis thaliana GN=PHT1-7 PE=2 SV=2 38 553 4.0E-95
sp|Q8H6G9|PHT17_ORYSJ Probable inorganic phosphate transporter 1-7 OS=Oryza sativa subsp. japonica GN=PHT1-7 PE=2 SV=1 38 551 9.0E-94
sp|Q8H6H0|PHT16_ORYSJ Inorganic phosphate transporter 1-6 OS=Oryza sativa subsp. japonica GN=PHT1-6 PE=1 SV=1 38 556 1.0E-92
sp|Q8GSD9|PHT12_ORYSJ Inorganic phosphate transporter 1-2 OS=Oryza sativa subsp. japonica GN=PTH1-2 PE=2 SV=1 38 550 6.0E-92
sp|Q7X7V2|PHT15_ORYSJ Probable inorganic phosphate transporter 1-5 OS=Oryza sativa subsp. japonica GN=PHT1-5 PE=2 SV=2 32 568 8.0E-92
sp|Q8VYM2|PHT11_ARATH Inorganic phosphate transporter 1-1 OS=Arabidopsis thaliana GN=PHT1-1 PE=1 SV=2 38 555 2.0E-91
sp|Q96303|PHT14_ARATH Inorganic phosphate transporter 1-4 OS=Arabidopsis thaliana GN=PHT1-4 PE=1 SV=1 33 548 2.0E-91
sp|O48639|PHT13_ARATH Probable inorganic phosphate transporter 1-3 OS=Arabidopsis thaliana GN=PHT1-3 PE=2 SV=1 38 551 3.0E-91
sp|Q01MW8|PHT14_ORYSI Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. indica GN=PHT1-4 PE=2 SV=2 38 552 3.0E-91
sp|Q8H6H2|PHT14_ORYSJ Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. japonica GN=PHT1-4 PE=2 SV=1 38 568 3.0E-91
sp|Q7XDZ7|PHT13_ORYSJ Probable inorganic phosphate transporter 1-3 OS=Oryza sativa subsp. japonica GN=PHT1-3 PE=2 SV=1 38 550 4.0E-89
sp|Q9ZWT3|PHT16_ARATH Probable inorganic phosphate transporter 1-6 OS=Arabidopsis thaliana GN=PHT1-6 PE=1 SV=1 38 551 2.0E-88
sp|Q8GYF4|PHT15_ARATH Probable inorganic phosphate transporter 1-5 OS=Arabidopsis thaliana GN=PHT1-5 PE=2 SV=2 33 553 4.0E-88
sp|Q9P6J9|YHD1_SCHPO Putative inorganic phosphate transporter C1683.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.01 PE=3 SV=1 52 546 3.0E-86
sp|O42885|YBN1_SCHPO Putative inorganic phosphate transporter C8E4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.01c PE=1 SV=2 50 546 6.0E-86
sp|Q8H074|PT112_ORYSJ Probable inorganic phosphate transporter 1-12 OS=Oryza sativa subsp. japonica GN=PHT1-12 PE=2 SV=1 38 563 6.0E-86
sp|Q8H6G8|PHT18_ORYSJ Probable inorganic phosphate transporter 1-8 OS=Oryza sativa subsp. japonica GN=PHT1-8 PE=2 SV=1 38 551 2.0E-85
sp|Q9Y7Q9|YCX2_SCHPO Probable metabolite transporter C2H8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC2H8.02 PE=1 SV=1 50 538 7.0E-85
sp|Q96243|PHT12_ARATH Probable inorganic phosphate transporter 1-2 OS=Arabidopsis thaliana GN=PHT1-2 PE=2 SV=2 38 555 3.0E-84
sp|Q8H6H4|PHT11_ORYSJ Inorganic phosphate transporter 1-1 OS=Oryza sativa subsp. japonica GN=PHT1-1 PE=2 SV=1 38 549 1.0E-83
sp|Q09852|YAEC_SCHPO Putative inorganic phosphate transporter C23D3.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23D3.12 PE=1 SV=1 25 565 6.0E-83
sp|Q7XRH8|PT113_ORYSJ Putative inorganic phosphate transporter 1-13 OS=Oryza sativa subsp. japonica GN=PHT1-13 PE=3 SV=2 37 548 6.0E-82
sp|Q94DB8|PT111_ORYSJ Inorganic phosphate transporter 1-11 OS=Oryza sativa subsp. japonica GN=PHT1-11 PE=2 SV=1 38 549 1.0E-81
sp|Q9SYQ1|PHT18_ARATH Probable inorganic phosphate transporter 1-8 OS=Arabidopsis thaliana GN=PHT1-8 PE=2 SV=2 38 556 2.0E-80
sp|Q69T94|PT110_ORYSJ Probable inorganic phosphate transporter 1-10 OS=Oryza sativa subsp. japonica GN=PHT1-10 PE=2 SV=1 38 564 6.0E-79
sp|Q9S735|PHT19_ARATH Probable inorganic phosphate transporter 1-9 OS=Arabidopsis thaliana GN=PHT1-9 PE=2 SV=1 38 549 9.0E-77
sp|Q8H6G7|PHT19_ORYSJ Probable inorganic phosphate transporter 1-9 OS=Oryza sativa subsp. japonica GN=PHT1-9 PE=2 SV=2 30 561 3.0E-75
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 107 557 2.0E-25
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 56 487 4.0E-17
sp|O94342|YHM9_SCHPO Probable metabolite transport protein C1271.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.09 PE=3 SV=1 50 575 8.0E-17
sp|Q4W8A3|S22A6_MACFA Solute carrier family 22 member 6 OS=Macaca fascicularis GN=SLC22A6 PE=1 SV=1 114 494 1.0E-15
sp|Q4U2R8|S22A6_HUMAN Solute carrier family 22 member 6 OS=Homo sapiens GN=SLC22A6 PE=1 SV=1 114 494 2.0E-15
sp|Q5RCH6|S22A6_PONAB Solute carrier family 22 member 6 OS=Pongo abelii GN=SLC22A6 PE=2 SV=1 114 494 2.0E-15
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 40 546 3.0E-15
sp|O35956|S22A6_RAT Solute carrier family 22 member 6 OS=Rattus norvegicus GN=Slc22a6 PE=1 SV=1 113 551 4.0E-15
sp|Q6A4L0|S22AD_MOUSE Solute carrier family 22 member 13 OS=Mus musculus GN=Slc22a13 PE=1 SV=3 113 570 1.0E-14
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 102 557 1.0E-14
sp|Q9TSY7|S22A6_RABIT Solute carrier family 22 member 6 OS=Oryctolagus cuniculus GN=SLC22A6 PE=2 SV=1 113 494 2.0E-14
sp|Q8MK48|S22A6_PIG Solute carrier family 22 member 6 OS=Sus scrofa GN=SLC22A6 PE=1 SV=2 114 494 1.0E-13
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 118 569 1.0E-13
sp|Q8VC69|S22A6_MOUSE Solute carrier family 22 member 6 OS=Mus musculus GN=Slc22a6 PE=1 SV=1 113 494 2.0E-13
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 29 540 2.0E-12
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 99 547 2.0E-12
sp|A6QLW8|S22A7_BOVIN Solute carrier family 22 member 7 OS=Bos taurus GN=SLC22A7 PE=2 SV=1 101 494 1.0E-11
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 114 549 2.0E-11
sp|Q91WU2|S22A7_MOUSE Solute carrier family 22 member 7 OS=Mus musculus GN=Slc22a7 PE=1 SV=1 102 494 2.0E-11
sp|Q1RPP5|S22A7_PIG Solute carrier family 22 member 7 OS=Sus scrofa GN=SLC22A7 PE=2 SV=1 101 494 4.0E-11
sp|Q864Z3|S22A6_BOVIN Solute carrier family 22 member 6 OS=Bos taurus GN=SLC22A6 PE=2 SV=2 114 494 6.0E-11
sp|Q9Y694|S22A7_HUMAN Solute carrier family 22 member 7 OS=Homo sapiens GN=SLC22A7 PE=1 SV=1 101 494 6.0E-11
sp|Q5RLM2|S22A7_RAT Solute carrier family 22 member 7 OS=Rattus norvegicus GN=Slc22a7 PE=1 SV=1 102 483 6.0E-11
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 104 546 2.0E-10
sp|Q5R540|S22A7_PONAB Solute carrier family 22 member 7 OS=Pongo abelii GN=SLC22A7 PE=2 SV=1 101 494 2.0E-10
sp|Q66KG0|S22AG_XENLA Solute carrier family 22 member 16 OS=Xenopus laevis GN=slc22a16 PE=2 SV=2 114 552 3.0E-10
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 49 294 4.0E-10
sp|Q9Y226|S22AD_HUMAN Solute carrier family 22 member 13 OS=Homo sapiens GN=SLC22A13 PE=2 SV=2 113 511 5.0E-10
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 103 547 6.0E-10
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 103 547 6.0E-10
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 99 547 1.0E-09
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 99 547 1.0E-09
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 107 546 1.0E-09
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 99 547 2.0E-09
sp|Q6PDF3|SVOPL_MOUSE Putative transporter SVOPL OS=Mus musculus GN=Svopl PE=2 SV=1 28 546 3.0E-09
sp|P25346|GIT1_YEAST Probable metabolite transport protein GIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIT1 PE=1 SV=1 107 503 3.0E-09
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 46 554 4.0E-09
sp|Q46909|YGCS_ECOLI Inner membrane metabolite transport protein YgcS OS=Escherichia coli (strain K12) GN=ygcS PE=1 SV=2 40 215 4.0E-09
sp|P0C0L7|PROP_ECOLI Proline/betaine transporter OS=Escherichia coli (strain K12) GN=proP PE=1 SV=1 52 329 4.0E-09
sp|P0C0L8|PROP_ECO57 Proline/betaine transporter OS=Escherichia coli O157:H7 GN=proP PE=3 SV=1 52 329 4.0E-09
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 110 481 4.0E-09
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 123 571 4.0E-09
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 114 559 5.0E-09
sp|Q9VCA2|ORCT_DROME Organic cation transporter protein OS=Drosophila melanogaster GN=Orct PE=1 SV=1 114 494 6.0E-09
sp|Q66J54|S226A_XENLA Solute carrier family 22 member 6-A OS=Xenopus laevis GN=slc22a6-a PE=2 SV=1 105 494 1.0E-08
sp|Q6NYN7|S22A6_DANRE Solute carrier family 22 member 6 OS=Danio rerio GN=slc22a6 PE=2 SV=1 114 489 1.0E-08
sp|Q8L7R8|STP3_ARATH Sugar transport protein 3 OS=Arabidopsis thaliana GN=STP3 PE=2 SV=2 162 548 2.0E-08
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 99 355 2.0E-08
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 99 355 2.0E-08
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 99 355 2.0E-08
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 124 547 2.0E-08
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 99 355 2.0E-08
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 37 492 2.0E-08
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 162 547 3.0E-08
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 99 283 3.0E-08
sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 99 283 3.0E-08
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 123 571 4.0E-08
sp|P40862|PROP_SALTY Proline/betaine transporter OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proP PE=3 SV=2 52 445 4.0E-08
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 163 546 5.0E-08
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 104 554 5.0E-08
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 39 277 6.0E-08
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 113 552 8.0E-08
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 98 555 9.0E-08
sp|Q8N434|SVOPL_HUMAN Putative transporter SVOPL OS=Homo sapiens GN=SVOPL PE=2 SV=2 114 546 1.0E-07
sp|Q3YAW7|S22A7_RABIT Solute carrier family 22 member 7 OS=Oryctolagus cuniculus GN=SLC22A7 PE=2 SV=1 114 494 1.0E-07
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 112 547 2.0E-07
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 112 545 2.0E-07
sp|Q80UJ1|S22AK_MOUSE Solute carrier family 22 member 20 OS=Mus musculus GN=Slc22a20 PE=1 SV=1 113 501 2.0E-07
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 112 546 2.0E-07
sp|Q7ZX53|S22FL_XENLA Solute carrier family 22 member 15-like OS=Xenopus laevis GN=slc22a15b PE=2 SV=1 113 552 3.0E-07
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 113 546 4.0E-07
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 162 552 4.0E-07
sp|Q6NUB3|S22AF_XENLA Solute carrier family 22 member 15 OS=Xenopus laevis GN=slc22a15 PE=2 SV=2 114 567 4.0E-07
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 57 573 4.0E-07
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3 104 554 4.0E-07
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 49 554 5.0E-07
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 112 547 6.0E-07
sp|Q6DFR1|S22AF_XENTR Solute carrier family 22 member 15 OS=Xenopus tropicalis GN=slc22a15 PE=2 SV=2 114 498 6.0E-07
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 124 315 8.0E-07
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 95 555 8.0E-07
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 99 547 9.0E-07
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 114 548 1.0E-06
sp|P38055|YDJE_ECOLI Inner membrane metabolite transport protein YdjE OS=Escherichia coli (strain K12) GN=ydjE PE=1 SV=2 39 547 1.0E-06
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 66 546 1.0E-06
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 99 547 1.0E-06
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 114 547 4.0E-06
sp|Q9LHQ6|OCT4_ARATH Organic cation/carnitine transporter 4 OS=Arabidopsis thaliana GN=OCT4 PE=2 SV=1 113 489 4.0E-06
sp|Q8IZD6|S22AF_HUMAN Solute carrier family 22 member 15 OS=Homo sapiens GN=SLC22A15 PE=2 SV=1 113 498 5.0E-06
sp|Q9SA36|OCT6_ARATH Organic cation/carnitine transporter 6 OS=Arabidopsis thaliana GN=OCT6 PE=2 SV=1 25 561 5.0E-06
sp|Q504N2|S22AF_MOUSE Solute carrier family 22 member 15 OS=Mus musculus GN=Slc22a15 PE=2 SV=3 114 498 5.0E-06
sp|Q28ES4|S22FL_XENTR Solute carrier family 22 member 15-like OS=Xenopus tropicalis GN=slc22a15b PE=2 SV=1 113 553 5.0E-06
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 114 547 6.0E-06
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 112 552 7.0E-06
sp|O30513|BENK_ACIAD Benzoate transport protein OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=benK PE=3 SV=2 41 493 8.0E-06
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 114 546 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.5

Transmembrane Domains

Domain # Start End Length
1 46 63 17
2 68 85 17
3 109 126 17
4 139 161 22
5 197 219 22
6 248 270 22
7 347 369 22
8 382 404 22
9 414 431 17
10 438 460 22
11 475 497 22
12 517 536 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1676
MAFSRSPDRTYGGNRAFHNFYNDYSHIPDPNLRRRLALSEIDKVPLGLYHVRAILVAGVGFLLDSYDIFAINLVT
VLLGMVFWGGSHREDGYGGNGGILPDGTNQALKGATSAGIIVGMVVFGWLADAMGRRKMYGIELAIIILATFSCA
LASASPAMGPSALLIMWRVLMGIGIGGDYPLSSVITSEFAPTRWRGAMIAAVFSMQGVGLLMSALVAFITTVAFK
ASFIDIKDETQCNAACQAAADRCWRIIVGVGAVPACLAMYYRITIPETPRYTFDVRHDVEKADADIRAYVQSKTK
DGQRGVSKRLSTTLLTVPRASWADLIAYFGEWAHLKVLIGTTMSWFFLDLAFYGLGLNSTVVLNAIGFGKGRNLY
EKLYNQAVGMIILACAGSLPGYLSAVLTIDTIGRKPLQVTGFLLLTAIFCILGFNLNQLSEGAMLALYVVGQFLF
SAGPNTTTFVVPGECFPTRYRATGHGLSAAMGKIGAVVAQVMSIPLLKPGSDDACAGERCSPKLDRLMQLFALFM
LLGTLVSLLIPETKGLTLEELSGESRQSYNAGCNGSITHETPPRRAWNPFGGGQPAGFFYPRSHAAMFGKGRRSP
RTDIMAPSPMEMAEPAPSSPSPNRGRRRRQYQQNNLRRLIWRRDGRTRRRDGSVDTNEIALRSCSPRSDRDNAAP
KTASSEPSEWRAGWGRIDRGPSPAGSNMELQDVGMLLGGDKGFGRG
Coding >Ophio5|1676
ATGGCCTTTTCCCGCAGCCCCGATCGCACCTATGGCGGTAACCGGGCCTTTCACAACTTCTACAATGACTACTCG
CATATTCCCGATCCCAATCTCCGTCGCCGGTTGGCCCTGTCTGAGATCGACAAGGTGCCACTCGGCCTTTATCAT
GTACGTGCCATTTTGGTCGCCGGCGTTGGCTTCCTGCTCGACTCTTACGACATCTTCGCCATTAATCTCGTCACC
GTACTACTCGGCATGGTCTTCTGGGGCGGATCTCATCGTGAGGACGGATATGGGGGCAACGGCGGCATCTTGCCA
GATGGCACCAACCAGGCACTCAAGGGTGCCACTAGTGCCGGCATCATCGTGGGAATGGTGGTGTTTGGGTGGCTC
GCCGATGCCATGGGTCGTAGAAAAATGTACGGCATCGAGCTCGCCATCATCATCCTGGCTACCTTTAGCTGCGCC
CTCGCCTCGGCGAGTCCGGCCATGGGACCCTCGGCCCTTCTCATCATGTGGCGCGTATTGATGGGCATCGGCATA
GGGGGCGATTACCCCCTATCATCCGTCATTACCTCTGAATTCGCCCCAACTCGCTGGCGCGGCGCCATGATCGCC
GCCGTCTTCTCGATGCAGGGCGTCGGCCTGCTCATGTCTGCCCTCGTTGCCTTCATCACCACCGTAGCCTTCAAA
GCATCCTTCATCGACATCAAGGACGAAACACAATGCAATGCCGCGTGTCAGGCTGCGGCGGACCGGTGCTGGCGC
ATCATCGTCGGCGTCGGTGCCGTTCCCGCATGTCTGGCCATGTATTATCGCATCACCATTCCTGAGACGCCGCGA
TACACCTTTGACGTGCGACACGACGTGGAAAAGGCAGACGCAGATATCAGGGCCTACGTTCAGAGCAAGACGAAG
GACGGCCAGCGCGGCGTCAGCAAGAGGCTCTCCACGACGCTACTCACTGTCCCTCGGGCATCTTGGGCTGATCTG
ATCGCCTACTTCGGGGAATGGGCCCATCTAAAGGTGCTTATTGGCACCACCATGTCGTGGTTCTTCCTCGATCTG
GCCTTTTACGGCCTCGGACTCAACAGCACCGTGGTCCTCAACGCCATCGGCTTCGGCAAGGGCCGCAACCTCTAT
GAGAAGCTATACAACCAGGCCGTCGGCATGATCATTCTGGCCTGCGCCGGCTCGCTACCGGGCTACCTCTCCGCC
GTGCTGACCATCGATACGATAGGCCGGAAGCCGCTTCAAGTGACGGGCTTCCTGCTCTTGACCGCCATCTTCTGC
ATCCTCGGCTTCAATCTAAACCAGCTCAGCGAGGGCGCCATGTTAGCCCTCTACGTCGTCGGCCAGTTCCTGTTC
AGCGCGGGTCCCAACACCACCACCTTTGTCGTGCCGGGAGAGTGCTTCCCCACCAGATACCGCGCCACGGGCCAC
GGCCTATCGGCAGCGATGGGAAAGATAGGGGCCGTGGTAGCCCAGGTGATGAGCATTCCGCTGCTGAAGCCGGGC
TCGGACGATGCCTGCGCGGGAGAGCGGTGTTCTCCCAAGCTGGACCGGCTGATGCAGCTGTTTGCGCTCTTCATG
CTACTCGGCACCCTGGTTTCGCTGCTGATTCCGGAGACGAAGGGTCTGACGCTAGAGGAGCTATCGGGTGAGTCG
CGGCAGAGCTATAATGCCGGCTGTAACGGGAGTATCACTCACGAGACGCCGCCACGACGGGCGTGGAATCCCTTC
GGGGGCGGCCAGCCGGCGGGCTTCTTCTACCCGCGATCACATGCGGCCATGTTCGGCAAGGGCCGTCGATCGCCA
CGGACAGACATCATGGCACCGTCACCGATGGAGATGGCCGAGCCGGCACCGTCTTCACCCTCACCTAACCGGGGA
CGCAGGCGACGTCAGTATCAGCAGAATAACCTACGGCGGCTCATTTGGCGGCGAGATGGCCGGACCCGACGCCGG
GACGGAAGCGTCGATACCAATGAGATCGCGCTGAGGAGCTGCAGCCCGAGATCGGATCGTGACAACGCGGCGCCC
AAGACGGCATCATCCGAGCCGTCGGAGTGGCGCGCCGGATGGGGCCGCATAGACCGGGGTCCGTCGCCGGCAGGG
AGCAACATGGAGCTTCAAGACGTGGGCATGTTACTGGGCGGGGATAAAGGGTTCGGGAGAGGA
Transcript >Ophio5|1676
ATGGCCTTTTCCCGCAGCCCCGATCGCACCTATGGCGGTAACCGGGCCTTTCACAACTTCTACAATGACTACTCG
CATATTCCCGATCCCAATCTCCGTCGCCGGTTGGCCCTGTCTGAGATCGACAAGGTGCCACTCGGCCTTTATCAT
GTACGTGCCATTTTGGTCGCCGGCGTTGGCTTCCTGCTCGACTCTTACGACATCTTCGCCATTAATCTCGTCACC
GTACTACTCGGCATGGTCTTCTGGGGCGGATCTCATCGTGAGGACGGATATGGGGGCAACGGCGGCATCTTGCCA
GATGGCACCAACCAGGCACTCAAGGGTGCCACTAGTGCCGGCATCATCGTGGGAATGGTGGTGTTTGGGTGGCTC
GCCGATGCCATGGGTCGTAGAAAAATGTACGGCATCGAGCTCGCCATCATCATCCTGGCTACCTTTAGCTGCGCC
CTCGCCTCGGCGAGTCCGGCCATGGGACCCTCGGCCCTTCTCATCATGTGGCGCGTATTGATGGGCATCGGCATA
GGGGGCGATTACCCCCTATCATCCGTCATTACCTCTGAATTCGCCCCAACTCGCTGGCGCGGCGCCATGATCGCC
GCCGTCTTCTCGATGCAGGGCGTCGGCCTGCTCATGTCTGCCCTCGTTGCCTTCATCACCACCGTAGCCTTCAAA
GCATCCTTCATCGACATCAAGGACGAAACACAATGCAATGCCGCGTGTCAGGCTGCGGCGGACCGGTGCTGGCGC
ATCATCGTCGGCGTCGGTGCCGTTCCCGCATGTCTGGCCATGTATTATCGCATCACCATTCCTGAGACGCCGCGA
TACACCTTTGACGTGCGACACGACGTGGAAAAGGCAGACGCAGATATCAGGGCCTACGTTCAGAGCAAGACGAAG
GACGGCCAGCGCGGCGTCAGCAAGAGGCTCTCCACGACGCTACTCACTGTCCCTCGGGCATCTTGGGCTGATCTG
ATCGCCTACTTCGGGGAATGGGCCCATCTAAAGGTGCTTATTGGCACCACCATGTCGTGGTTCTTCCTCGATCTG
GCCTTTTACGGCCTCGGACTCAACAGCACCGTGGTCCTCAACGCCATCGGCTTCGGCAAGGGCCGCAACCTCTAT
GAGAAGCTATACAACCAGGCCGTCGGCATGATCATTCTGGCCTGCGCCGGCTCGCTACCGGGCTACCTCTCCGCC
GTGCTGACCATCGATACGATAGGCCGGAAGCCGCTTCAAGTGACGGGCTTCCTGCTCTTGACCGCCATCTTCTGC
ATCCTCGGCTTCAATCTAAACCAGCTCAGCGAGGGCGCCATGTTAGCCCTCTACGTCGTCGGCCAGTTCCTGTTC
AGCGCGGGTCCCAACACCACCACCTTTGTCGTGCCGGGAGAGTGCTTCCCCACCAGATACCGCGCCACGGGCCAC
GGCCTATCGGCAGCGATGGGAAAGATAGGGGCCGTGGTAGCCCAGGTGATGAGCATTCCGCTGCTGAAGCCGGGC
TCGGACGATGCCTGCGCGGGAGAGCGGTGTTCTCCCAAGCTGGACCGGCTGATGCAGCTGTTTGCGCTCTTCATG
CTACTCGGCACCCTGGTTTCGCTGCTGATTCCGGAGACGAAGGGTCTGACGCTAGAGGAGCTATCGGGTGAGTCG
CGGCAGAGCTATAATGCCGGCTGTAACGGGAGTATCACTCACGAGACGCCGCCACGACGGGCGTGGAATCCCTTC
GGGGGCGGCCAGCCGGCGGGCTTCTTCTACCCGCGATCACATGCGGCCATGTTCGGCAAGGGCCGTCGATCGCCA
CGGACAGACATCATGGCACCGTCACCGATGGAGATGGCCGAGCCGGCACCGTCTTCACCCTCACCTAACCGGGGA
CGCAGGCGACGTCAGTATCAGCAGAATAACCTACGGCGGCTCATTTGGCGGCGAGATGGCCGGACCCGACGCCGG
GACGGAAGCGTCGATACCAATGAGATCGCGCTGAGGAGCTGCAGCCCGAGATCGGATCGTGACAACGCGGCGCCC
AAGACGGCATCATCCGAGCCGTCGGAGTGGCGCGCCGGATGGGGCCGCATAGACCGGGGTCCGTCGCCGGCAGGG
AGCAACATGGAGCTTCAAGACGTGGGCATGTTACTGGGCGGGGATAAAGGGTTCGGGAGAGGATAA
Gene >Ophio5|1676
ATGGCCTTTTCCCGCAGCCCCGATCGCACCTATGGCGGTAACCGGGCCTTTCACAACTTCTACAATGACTACTCG
CATATTCCCGATCCCAATCTCCGTCGCCGGTTGGCCCTGTCTGAGATCGACAAGGTGCCACTCGGCCTTTATCGT
AGGTTGTCCCGGCTCAGCGTGTCTTTTCTGTGCTGGGTGAGCTGACAGCCGTGCAGATGTACGTGCCATTTTGGT
CGCCGGCGTTGGCTTCCTGCTCGACTCTTACGACATCTTCGCCATTAATCTCGTCACCGTACTACTCGGCATGGT
CTTCTGGGGCGGATCTCATCGTGAGGACGGATATGGGGGCAACGGCGGCATCTTGCCAGATGGCACCAACCAGGC
ACTCAAGGGTGCCACTAGTGCCGGCATCATCGTGGGAATGGTGGTGTTTGGGTGGCTCGCCGAGTGAGCAGCAGC
CCACACAGTCATGGTTGACGCCGCTAACACCAACCACCAGTGCCATGGGTCGTAGAAAAATGTACGGCATCGAGC
TCGCCATCATCATCCTGGCTACCTTTAGCTGCGCCCTCGCCTCGGCGAGTCCGGCCATGGGACCCTCGGCCCTTC
TCATCATGTGGCGCGTATTGATGGGCATCGGCATAGGGGGCGATTACCCCCTATCATCCGTCATTACCTCTGAGT
GAGCACCGCCTACGAAATCAACTAACAGCTCACCGCCACTGACGACTATCCGAACAAGATTCGCCCCAACTCGCT
GGCGCGGCGCCATGATCGCCGCCGTCTTCTCGATGCAGGGCGTCGGCCTGCTCATGTCTGCCCTCGTTGCCTTCA
TCACCACCGTAGCCTTCAAAGCATCCTTCATCGACATCAAGGACGAAACACAATGCAATGCCGCGTGTCAGGCTG
CGGCGGACCGGTGCTGGCGCATCATCGTCGGCGTCGGTGCCGTTCCCGCATGTCTGGCCATGTATTATCGCATCA
CCATTCCTGAGACGCCGCGATACACCTTTGACGTGCGACACGACGTGGAAAAGGCAGACGCAGATATCAGGGCCT
ACGTTCAGAGCAAGACGAAGGACGGCCAGCGCGGCGTCAGCAAGAGGCTCTCCACGACGCTACTCACTGTCCCTC
GGGCATCTTGGGCTGATCTGATCGCCTACTTCGGGGAATGGGCCCATCTAAAGGTGCTTATTGGCACCACCATGT
CGTGGTTCTTCCTCGTGAGTGTCTCTCCCATCATCAAGGTACGACGGCTACTGACGAAGACTCACGTAGGATCTG
GCCTTTTACGGCCTCGGACTCAACAGCACCGTGGTCCTCAACGCCATCGGCTTCGGCAAGGGCCGCAACCTCTAT
GAGAAGCTATACAACCAGGCCGTCGGCATGATCATTCTGGCCTGCGCCGGCTCGCTACCGGGCTACCTCTCCGCC
GTGCTGACCATCGATACGATAGGCCGGAAGCCGCTTCAAGTGACGGGCTTCCTGCTCTTGACCGCCATCTTCTGC
ATCCTCGGCTTCAATCTAAACCAGCTCAGCGAGGGCGCCATGTTAGCCCTCTACGTCGTCGGCCAGTTCCTGTTC
AGCGCGGGTCCCAACACCACCACCTTTGTCGTGCCGGGAGAGTGCTTCCCCACCAGATACCGCGCCACGGGCCAC
GGCCTATCGGCAGCGATGGGAAAGATAGGGGCCGTGGTAGCCCAGGTGATGAGCATTCCGCTGCTGAAGCCGGGC
TCGGACGATGCCTGCGCGGGAGAGCGGTGTTCTCCCAAGCTGGACCGGCTGATGCAGCTGTTTGCGCTCTTCATG
CTACTCGGCACCCTGGTTTCGCTGCTGATTCCGGAGACGAAGGGTCTGACGCTAGAGGAGCTATCGGGTGAGTCG
CGGCAGAGCTATAATGCCGGCTGTAACGGGAGTATCACTCACGAGACGCCGCCACGACGGGCGTGGAATCCCTTC
GGGGGCGGCCAGCCGGCGGGCTTCTTCTACCCGCGATCACATGCGGCCATGTTCGGCAAGGGCCGTCGATCGCCA
CGGACAGACATCATGGCACCGTCACCGATGGAGATGGCCGAGCCGGCACCGTCTTCACCCTCACCTAACCGGGGA
CGCAGGCGACGTCAGTATCAGCAGAATAACCTACGGCGGCTCATTTGGCGGCGAGATGGCCGGACCCGACGCCGG
GACGGAAGCGTCGATACCAATGAGATCGCGCTGAGGAGCTGCAGCCCGAGATCGGATCGTGACAACGCGGCGCCC
AAGACGGCATCATCCGAGCCGTCGGAGTGGCGCGCCGGATGGGGCCGCATAGACCGGGGTCCGTCGCCGGCAGGG
AGCAACATGGAGCTTCAAGACGTGGGCATGTTACTGGGCGGGGATAAAGGGTTCGGGAGAGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail