Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1675
Gene name
Locationscaffold_161:12036..12492
Strand+
Gene length (bp)456
Transcript length (bp)276
Coding sequence length (bp)273
Protein length (aa) 91

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1107 0.1273 0.9286 0.0331 0.0729 0.0175 0.0534 0.0605 0.0432 0.0045

SignalP

SignalP signal predicted Location Score
Yes 1 - 45 0.997147

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 78.89 25.92 131.86
CcL In ants, during behavior modification 1792.67 696.42 2888.91
CcD In ants, recently dead 592.02 321.52 862.51

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.000286 yes

Orthologs

Orthofinder run ID4
Orthogroup7429
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06345
Ophiocordyceps kimflemingae Ophio5|1675 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1675
MALQKEASLAPSSITTPPKRIMMKFLLLASLLSTAAALPAQQANAIDASRAFTCPSRVQAFCRASNVHSGCTFNG
NFRSDAMETCKQCRCG
Coding >Ophio5|1675
ATGGCGTTGCAAAAGGAAGCATCCCTTGCGCCGAGCTCGATTACTACGCCGCCCAAAAGAATCATGATGAAGTTC
CTCCTCCTCGCCTCTCTCCTCAGCACCGCCGCGGCGCTGCCCGCCCAACAGGCCAACGCCATCGACGCCAGTAGG
GCATTCACCTGTCCATCTCGTGTGCAGGCTTTTTGCCGCGCGTCAAATGTGCATTCGGGTTGCACGTTCAACGGA
AACTTCCGCTCCGATGCAATGGAGACGTGCAAGCAGTGTCGTTGTGGC
Transcript >Ophio5|1675
ATGGCGTTGCAAAAGGAAGCATCCCTTGCGCCGAGCTCGATTACTACGCCGCCCAAAAGAATCATGATGAAGTTC
CTCCTCCTCGCCTCTCTCCTCAGCACCGCCGCGGCGCTGCCCGCCCAACAGGCCAACGCCATCGACGCCAGTAGG
GCATTCACCTGTCCATCTCGTGTGCAGGCTTTTTGCCGCGCGTCAAATGTGCATTCGGGTTGCACGTTCAACGGA
AACTTCCGCTCCGATGCAATGGAGACGTGCAAGCAGTGTCGTTGTGGCTAG
Gene >Ophio5|1675
ATGGCGTTGCAAAAGGAAGCATCCCTTGCGCCGAGCTGTATATAACTTCCTGTCCCCTTTGCATCAACACGCTCA
TGTCCATCACTTCAGCGATTACTACGCCGCCCAAAAGAATCATGATGAAGGTGCGTTTTTTCTTTTCACGCACAA
GCAGCCTTAATCACCAACCAGCTAAGCATTTGTCTCTTTAGTTCCTCCTCCTCGCCTCTCTCCTCAGCACCGCCG
CGGCGCTGCCCGCCCAACAGGCCAACGCCATCGACGCCAGTAGGGCATTCACCTGTCCATCTCGTGTGCAGGCTT
TTTGCCGCGCGTCAAATGTGCATTCGGGTTGCACGTTCAACGGAAACTTCCGCTCCGATGCAATGGAGACGTGCA
AGCAGTGTCGTTGTGGTGAGTCATTTGGCTGCTGGCCCTTGTGCTGAGTGAGGGAGGAACTGACGATGAGGACCA
GGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail