Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1671
Gene name
Locationscaffold_161:5787..6344
Strand+
Gene length (bp)557
Transcript length (bp)441
Coding sequence length (bp)438
Protein length (aa) 146

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00581 Rhodanese Rhodanese-like domain 4.3E-13 21 127

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P42937|YCH1_YEAST CDC25-like phosphatase YCH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCH1 PE=1 SV=1 20 145 9.0E-23
sp|Q336V5|ACR21_ORYSJ Arsenate reductase 2.1 OS=Oryza sativa subsp. japonica GN=ACR2.1 PE=1 SV=1 34 126 2.0E-15
sp|Q10SX6|ACR22_ORYSJ Arsenate reductase 2.2 OS=Oryza sativa subsp. japonica GN=ACR2.2 PE=1 SV=1 33 126 4.0E-15
sp|Q8GY31|CDC25_ARATH Dual specificity phosphatase Cdc25 OS=Arabidopsis thaliana GN=CDC25 PE=1 SV=1 32 126 8.0E-15
sp|Q03019|TWINE_DROME Cdc25-like protein phosphatase twine OS=Drosophila melanogaster GN=twe PE=1 SV=2 10 130 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P42937|YCH1_YEAST CDC25-like phosphatase YCH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCH1 PE=1 SV=1 20 145 9.0E-23
sp|Q336V5|ACR21_ORYSJ Arsenate reductase 2.1 OS=Oryza sativa subsp. japonica GN=ACR2.1 PE=1 SV=1 34 126 2.0E-15
sp|Q10SX6|ACR22_ORYSJ Arsenate reductase 2.2 OS=Oryza sativa subsp. japonica GN=ACR2.2 PE=1 SV=1 33 126 4.0E-15
sp|Q8GY31|CDC25_ARATH Dual specificity phosphatase Cdc25 OS=Arabidopsis thaliana GN=CDC25 PE=1 SV=1 32 126 8.0E-15
sp|Q03019|TWINE_DROME Cdc25-like protein phosphatase twine OS=Drosophila melanogaster GN=twe PE=1 SV=2 10 130 2.0E-13
sp|Q8WZK3|IBP1_SCHPO Dual specificity phosphatase ibp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ibp1 PE=1 SV=1 29 137 1.0E-11
sp|Q06597|ARR2_YEAST Arsenical-resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARR2 PE=3 SV=1 27 99 8.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1671
MSTASSVATLRRMTAQTLSEKMLQEQETAETSFAVVDVRDDDYIGGHIRGSTNVPSRQLDAMMPTLVRNLQNKQA
VVFHCALSQQRGPSAALKYLRERDSLLERLGEAGSDGQIVYVLDRGFSGWQEVFGDDERLTEGYVKDLWRD
Coding >Ophio5|1671
ATGTCGACGGCAAGCTCTGTGGCGACGCTGCGGCGCATGACAGCCCAGACGCTCTCGGAGAAGATGCTGCAGGAG
CAGGAGACAGCAGAGACGAGCTTTGCGGTGGTGGACGTGCGCGACGACGACTACATCGGAGGCCACATCCGCGGC
TCAACCAACGTGCCCAGCCGACAGCTCGACGCCATGATGCCGACACTCGTCCGTAATCTCCAGAACAAGCAGGCG
GTCGTCTTCCACTGCGCGCTGAGCCAACAGCGCGGGCCCAGCGCGGCGCTCAAGTACCTGCGGGAGAGGGATAGC
CTGCTCGAGAGGCTGGGCGAGGCGGGCAGCGACGGCCAGATTGTCTACGTGCTCGATCGGGGCTTTTCCGGCTGG
CAAGAGGTGTTTGGTGACGATGAGCGGCTGACAGAGGGATATGTCAAGGATCTTTGGCGGGAT
Transcript >Ophio5|1671
ATGTCGACGGCAAGCTCTGTGGCGACGCTGCGGCGCATGACAGCCCAGACGCTCTCGGAGAAGATGCTGCAGGAG
CAGGAGACAGCAGAGACGAGCTTTGCGGTGGTGGACGTGCGCGACGACGACTACATCGGAGGCCACATCCGCGGC
TCAACCAACGTGCCCAGCCGACAGCTCGACGCCATGATGCCGACACTCGTCCGTAATCTCCAGAACAAGCAGGCG
GTCGTCTTCCACTGCGCGCTGAGCCAACAGCGCGGGCCCAGCGCGGCGCTCAAGTACCTGCGGGAGAGGGATAGC
CTGCTCGAGAGGCTGGGCGAGGCGGGCAGCGACGGCCAGATTGTCTACGTGCTCGATCGGGGCTTTTCCGGCTGG
CAAGAGGTGTTTGGTGACGATGAGCGGCTGACAGAGGGATATGTCAAGGATCTTTGGCGGGATTGA
Gene >Ophio5|1671
ATGTCGACGGCAAGCTCTGTGGCGACGCTGCGGCGCATGACAGCCCAGACGCTCTCGGAGAAGATGCTGCAGGAG
CAGGAGACAGCAGAGACGAGCTTTGCGGTGGTGGACGTGCGCGACGACGGTGAGAAGATGGCCTTTTTCTTCCTG
CCAGGAGACAGTACTGTTCCTGTTTATCTTTGCTGACGATTGGTTTCCTCTCATCTGTCTACGAGACATGACTGA
CTTCTTTCCATTCAGACTACATCGGAGGCCACATCCGCGGCTCAACCAACGTGCCCAGCCGACAGCTCGACGCCA
TGATGCCGACACTCGTCCGTAATCTCCAGAACAAGCAGGCGGTCGTCTTCCACTGCGCGCTGAGCCAACAGCGCG
GGCCCAGCGCGGCGCTCAAGTACCTGCGGGAGAGGGATAGCCTGCTCGAGAGGCTGGGCGAGGCGGGCAGCGACG
GCCAGATTGTCTACGTGCTCGATCGGGGCTTTTCCGGCTGGCAAGAGGTGTTTGGTGACGATGAGCGGCTGACAG
AGGGATATGTCAAGGATCTTTGGCGGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail