Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1669
Gene name
Locationscaffold_161:1657..2929
Strand-
Gene length (bp)1272
Transcript length (bp)1158
Coding sequence length (bp)1155
Protein length (aa) 385

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01087 GalP_UDP_transf Galactose-1-phosphate uridyl transferase, N-terminal domain 4.5E-66 7 207
PF02744 GalP_UDP_tr_C Galactose-1-phosphate uridyl transferase, C-terminal domain 7.7E-58 214 370

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RYE7|GAL7_NEUCR Galactose-1-phosphate uridylyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gal-7 PE=3 SV=1 1 382 0.0E+00
sp|Q96UI1|GAL7_HYPJE Galactose-1-phosphate uridylyltransferase OS=Hypocrea jecorina GN=gal7 PE=3 SV=1 1 381 0.0E+00
sp|P09580|GAL7_KLULA Galactose-1-phosphate uridylyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAL7 PE=3 SV=2 6 377 5.0E-132
sp|Q9HDU5|GAL7_SCHPO Galactose-1-phosphate uridylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gal7 PE=3 SV=1 6 381 4.0E-131
sp|P08431|GAL7_YEAST Galactose-1-phosphate uridylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL7 PE=1 SV=4 10 377 1.0E-125
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RYE7|GAL7_NEUCR Galactose-1-phosphate uridylyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gal-7 PE=3 SV=1 1 382 0.0E+00
sp|Q96UI1|GAL7_HYPJE Galactose-1-phosphate uridylyltransferase OS=Hypocrea jecorina GN=gal7 PE=3 SV=1 1 381 0.0E+00
sp|P09580|GAL7_KLULA Galactose-1-phosphate uridylyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAL7 PE=3 SV=2 6 377 5.0E-132
sp|Q9HDU5|GAL7_SCHPO Galactose-1-phosphate uridylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gal7 PE=3 SV=1 6 381 4.0E-131
sp|P08431|GAL7_YEAST Galactose-1-phosphate uridylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL7 PE=1 SV=4 10 377 1.0E-125
sp|P22714|GAL7_SALTY Galactose-1-phosphate uridylyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=galT PE=3 SV=2 8 380 2.0E-108
sp|P09148|GAL7_ECOLI Galactose-1-phosphate uridylyltransferase OS=Escherichia coli (strain K12) GN=galT PE=1 SV=2 8 380 3.0E-108
sp|P31764|GAL7_HAEIN Galactose-1-phosphate uridylyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=galT PE=3 SV=2 11 379 3.0E-108
sp|P0CN77|GAL7_CRYNB Galactose-1-phosphate uridylyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GAL7 PE=3 SV=1 6 370 1.0E-107
sp|P0CN76|GAL7_CRYNJ Galactose-1-phosphate uridylyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GAL7 PE=3 SV=1 6 370 1.0E-107
sp|Q03249|GALT_MOUSE Galactose-1-phosphate uridylyltransferase OS=Mus musculus GN=Galt PE=1 SV=3 11 371 1.0E-104
sp|P07902|GALT_HUMAN Galactose-1-phosphate uridylyltransferase OS=Homo sapiens GN=GALT PE=1 SV=3 7 371 9.0E-103
sp|P43424|GALT_RAT Galactose-1-phosphate uridylyltransferase OS=Rattus norvegicus GN=Galt PE=2 SV=1 11 370 1.0E-102
sp|Q9VMA2|GALT_DROME Probable galactose-1-phosphate uridylyltransferase OS=Drosophila melanogaster GN=Galt PE=2 SV=2 11 377 7.0E-102
sp|Q27536|GALT_CAEEL Probable galactose-1-phosphate uridylyltransferase OS=Caenorhabditis elegans GN=ZK1058.3 PE=3 SV=1 10 382 6.0E-79
sp|O33836|GAL7_THEMA Galactose-1-phosphate uridylyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=galT PE=3 SV=1 13 376 7.0E-34
sp|P13212|GAL7_STRLI Galactose-1-phosphate uridylyltransferase OS=Streptomyces lividans GN=galT PE=3 SV=2 51 372 3.0E-23
sp|Q9FK51|AGLUP_ARATH ADP-glucose phosphorylase OS=Arabidopsis thaliana GN=At5g18200 PE=1 SV=1 3 370 3.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0006012 galactose metabolic process Yes
GO:0008108 UDP-glucose:hexose-1-phosphate uridylyltransferase activity Yes
GO:0070569 uridylyltransferase activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016779 nucleotidyltransferase activity No
GO:0005996 monosaccharide metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0019318 hexose metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044281 small molecule metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Peroxisome Peroxisomal targeting signal 0.3024 0.5016 0.0506 0.0466 0.2124 0.0243 0.0957 0.108 0.141 0.8017

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4227
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|686
Ophiocordyceps australis map64 (Brazil) OphauB2|5643
Ophiocordyceps camponoti-floridani Ophcf2|06339
Ophiocordyceps camponoti-rufipedis Ophun1|3521
Ophiocordyceps kimflemingae Ophio5|1669 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8626

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1669
MPDQILDDISHRRYNPLTDSWLLVSPHRTKRPWQGAQEAAVTGKLPEHDPKCYLCPGNTRAAGDANPNYDKTFAF
VNDYSAVREKQPAYEPHEADDNESSLLRAEAVTGVCYVLTFSPKHNLTLADMTATEILPTIEHWTCLYANHLAAS
NLLARLAAKLDLSMARDAAPVPTCEYRYMQVFENKGAAMGCSNPHPHCQVWTTSTMPDEPGRELAQMAKYRAQHD
GRHLLGDYVRMELAKAERVLWHNDGFVVVCPWWAVWPFEVLIMPKRHVRSLVDLQPRERLLFAEAIHDVTRRYDN
LFECSFPYSSGIHQAPLKGTDEEMENAYLHMHFYPPLLRSASVKKFLVGYELMAQPQRDITPEQAAARLRSCGGE
VYRKSIEKRP
Coding >Ophio5|1669
ATGCCGGATCAGATCCTCGACGACATTTCACACAGGCGATACAACCCGCTCACCGACAGTTGGCTCCTCGTCTCG
CCTCATCGCACGAAGCGCCCATGGCAGGGCGCTCAGGAGGCTGCCGTTACCGGAAAGCTGCCCGAGCACGACCCA
AAGTGCTATCTCTGCCCAGGCAACACACGCGCCGCCGGCGACGCGAACCCCAACTATGATAAGACGTTCGCCTTT
GTCAACGATTACAGCGCCGTCCGCGAGAAGCAGCCCGCTTACGAGCCGCATGAAGCTGATGATAATGAGTCGTCG
CTGCTTCGCGCAGAGGCCGTCACGGGCGTTTGCTACGTGCTCACCTTCTCGCCCAAGCATAACCTGACGCTCGCC
GACATGACGGCTACCGAGATACTCCCCACGATCGAGCACTGGACGTGCCTCTACGCCAATCATTTAGCCGCGTCG
AACCTGCTGGCTCGGCTGGCGGCGAAGCTGGATCTGTCGATGGCGCGCGACGCCGCGCCCGTGCCGACCTGCGAG
TATCGCTATATGCAGGTGTTCGAGAACAAGGGCGCCGCCATGGGCTGCTCCAATCCGCACCCGCACTGCCAGGTG
TGGACGACGTCGACGATGCCCGATGAGCCGGGACGCGAGCTCGCCCAGATGGCCAAATATCGCGCCCAGCACGAC
GGCCGCCACCTGCTGGGCGACTACGTCCGCATGGAGCTGGCAAAGGCCGAGCGCGTACTGTGGCACAACGACGGC
TTTGTCGTCGTCTGCCCCTGGTGGGCTGTGTGGCCCTTTGAGGTGCTCATTATGCCCAAGCGCCATGTCCGGTCT
CTCGTCGATCTCCAACCTCGCGAGCGACTGCTGTTTGCCGAGGCCATTCACGATGTGACGCGCCGCTACGACAAC
CTGTTCGAGTGCAGCTTTCCCTACAGTTCGGGCATCCATCAGGCGCCGCTCAAAGGGACTGATGAGGAGATGGAG
AACGCCTACTTGCACATGCACTTTTACCCGCCGCTCCTACGCTCCGCCTCGGTCAAAAAGTTCCTGGTCGGCTAC
GAGCTCATGGCTCAGCCACAGCGGGACATTACGCCGGAGCAGGCCGCCGCTCGTCTGCGGAGCTGCGGCGGCGAA
GTGTATCGCAAGAGCATTGAGAAGCGACCG
Transcript >Ophio5|1669
ATGCCGGATCAGATCCTCGACGACATTTCACACAGGCGATACAACCCGCTCACCGACAGTTGGCTCCTCGTCTCG
CCTCATCGCACGAAGCGCCCATGGCAGGGCGCTCAGGAGGCTGCCGTTACCGGAAAGCTGCCCGAGCACGACCCA
AAGTGCTATCTCTGCCCAGGCAACACACGCGCCGCCGGCGACGCGAACCCCAACTATGATAAGACGTTCGCCTTT
GTCAACGATTACAGCGCCGTCCGCGAGAAGCAGCCCGCTTACGAGCCGCATGAAGCTGATGATAATGAGTCGTCG
CTGCTTCGCGCAGAGGCCGTCACGGGCGTTTGCTACGTGCTCACCTTCTCGCCCAAGCATAACCTGACGCTCGCC
GACATGACGGCTACCGAGATACTCCCCACGATCGAGCACTGGACGTGCCTCTACGCCAATCATTTAGCCGCGTCG
AACCTGCTGGCTCGGCTGGCGGCGAAGCTGGATCTGTCGATGGCGCGCGACGCCGCGCCCGTGCCGACCTGCGAG
TATCGCTATATGCAGGTGTTCGAGAACAAGGGCGCCGCCATGGGCTGCTCCAATCCGCACCCGCACTGCCAGGTG
TGGACGACGTCGACGATGCCCGATGAGCCGGGACGCGAGCTCGCCCAGATGGCCAAATATCGCGCCCAGCACGAC
GGCCGCCACCTGCTGGGCGACTACGTCCGCATGGAGCTGGCAAAGGCCGAGCGCGTACTGTGGCACAACGACGGC
TTTGTCGTCGTCTGCCCCTGGTGGGCTGTGTGGCCCTTTGAGGTGCTCATTATGCCCAAGCGCCATGTCCGGTCT
CTCGTCGATCTCCAACCTCGCGAGCGACTGCTGTTTGCCGAGGCCATTCACGATGTGACGCGCCGCTACGACAAC
CTGTTCGAGTGCAGCTTTCCCTACAGTTCGGGCATCCATCAGGCGCCGCTCAAAGGGACTGATGAGGAGATGGAG
AACGCCTACTTGCACATGCACTTTTACCCGCCGCTCCTACGCTCCGCCTCGGTCAAAAAGTTCCTGGTCGGCTAC
GAGCTCATGGCTCAGCCACAGCGGGACATTACGCCGGAGCAGGCCGCCGCTCGTCTGCGGAGCTGCGGCGGCGAA
GTGTATCGCAAGAGCATTGAGAAGCGACCGTAG
Gene >Ophio5|1669
ATGCCGGATCAGATCCTCGACGACATTTCACACAGGCGATACAACCCGCTCACCGACAGTTGGCTCCTCGTCTCG
CCTCATCGCACGAAGCGCCCATGGCAGTGAGTGACGACTGCCGTGCTCTGGCTTCCCAGCGACTGACCAGATCGG
GCTGCCAGGGGCGCTCAGGAGGCTGCCGTTACCGGAAAGCTGCCCGAGCACGACCCAAAGGCGTGTGGCTGCGCT
TCAACTTCATCGGGCTATGTCATCGACCGCTAACCGTCGCAGTGCTATCTCTGCCCAGGCAACACACGCGCCGCC
GGCGACGCGAACCCCAACTATGATAAGACGTTCGCCTTTGTCAACGATTACAGCGCCGTCCGCGAGAAGCAGCCC
GCTTACGAGCCGCATGAAGCTGATGATAATGAGTCGTCGCTGCTTCGCGCAGAGGCCGTCACGGGCGTTTGCTAC
GTGCTCACCTTCTCGCCCAAGCATAACCTGACGCTCGCCGACATGACGGCTACCGAGATACTCCCCACGATCGAG
CACTGGACGTGCCTCTACGCCAATCATTTAGCCGCGTCGAACCTGCTGGCTCGGCTGGCGGCGAAGCTGGATCTG
TCGATGGCGCGCGACGCCGCGCCCGTGCCGACCTGCGAGTATCGCTATATGCAGGTGTTCGAGAACAAGGGCGCC
GCCATGGGCTGCTCCAATCCGCACCCGCACTGCCAGGTGTGGACGACGTCGACGATGCCCGATGAGCCGGGACGC
GAGCTCGCCCAGATGGCCAAATATCGCGCCCAGCACGACGGCCGCCACCTGCTGGGCGACTACGTCCGCATGGAG
CTGGCAAAGGCCGAGCGCGTACTGTGGCACAACGACGGCTTTGTCGTCGTCTGCCCCTGGTGGGCTGTGTGGCCC
TTTGAGGTGCTCATTATGCCCAAGCGCCATGTCCGGTCTCTCGTCGATCTCCAACCTCGCGAGCGACTGCTGTTT
GCCGAGGCCATTCACGATGTGACGCGCCGCTACGACAACCTGTTCGAGTGCAGCTTTCCCTACAGTTCGGGCATC
CATCAGGCGCCGCTCAAAGGGACTGATGAGGAGATGGAGAACGCCTACTTGCACATGCACTTTTACCCGCCGCTC
CTACGCTCCGCCTCGGTCAAAAAGTTCCTGGTCGGCTACGAGCTCATGGCTCAGCCACAGCGGGACATTACGCCG
GAGCAGGCCGCCGCTCGTCTGCGGAGCTGCGGCGGCGAAGTGTATCGCAAGAGCATTGAGAAGCGACCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail