Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1667
Gene name
Locationscaffold_1605:50..586
Strand+
Gene length (bp)536
Transcript length (bp)432
Coding sequence length (bp)429
Protein length (aa) 143

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 1 142 1.0E-16
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 11 143 5.0E-14
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 3 142 3.0E-13
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 1 143 5.0E-11
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 3 143 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 1 142 1.0E-16
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 11 143 5.0E-14
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 3 142 3.0E-13
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 1 143 5.0E-11
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 3 143 2.0E-09
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 14 133 5.0E-08
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 14 142 1.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 49 71 22
3 86 105 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1667
MGGALMSFLNPRTNRSGVLAGIYLVNAVVAPLTVFYSLTVANCAGGTKRAFAAALVSGSFSLGNIIGPQTFQARD
APDFRPAKLAVMGTQAGCALVTILLFLYYVQANRRRNDRSRQQEEAFMSPEVWATMTDKENKQFRYSY
Coding >Ophio5|1667
ATGGGTGGCGCCCTCATGTCCTTCTTGAACCCCCGAACGAACCGCTCCGGCGTCCTGGCCGGCATCTACCTCGTC
AACGCCGTCGTCGCCCCCTTGACCGTCTTTTACAGCTTGACCGTCGCCAACTGCGCCGGAGGCACCAAACGCGCC
TTCGCCGCCGCCCTCGTCAGCGGCTCCTTCTCCCTCGGCAACATCATCGGCCCCCAGACCTTCCAGGCCCGCGAC
GCGCCCGACTTCCGTCCCGCCAAGCTCGCCGTCATGGGCACCCAGGCCGGCTGCGCCTTGGTCACCATTCTTCTC
TTCCTCTACTACGTACAGGCCAACCGGCGGCGCAACGACCGCAGCCGTCAACAGGAGGAGGCCTTCATGTCCCCC
GAAGTCTGGGCTACCATGACGGATAAGGAGAATAAGCAGTTTCGGTATAGCTAT
Transcript >Ophio5|1667
ATGGGTGGCGCCCTCATGTCCTTCTTGAACCCCCGAACGAACCGCTCCGGCGTCCTGGCCGGCATCTACCTCGTC
AACGCCGTCGTCGCCCCCTTGACCGTCTTTTACAGCTTGACCGTCGCCAACTGCGCCGGAGGCACCAAACGCGCC
TTCGCCGCCGCCCTCGTCAGCGGCTCCTTCTCCCTCGGCAACATCATCGGCCCCCAGACCTTCCAGGCCCGCGAC
GCGCCCGACTTCCGTCCCGCCAAGCTCGCCGTCATGGGCACCCAGGCCGGCTGCGCCTTGGTCACCATTCTTCTC
TTCCTCTACTACGTACAGGCCAACCGGCGGCGCAACGACCGCAGCCGTCAACAGGAGGAGGCCTTCATGTCCCCC
GAAGTCTGGGCTACCATGACGGATAAGGAGAATAAGCAGTTTCGGTATAGCTATTGA
Gene >Ophio5|1667
ATGGGTGGCGCCCTCATGTCCTTCTTGAACCCCCGAACGAACCGCTCCGGCGTCCTGGCCGGCATCTACCTCGTC
AACGCCGTCGTCGCCCCCTTGACCGTCTTTTACAGCGTATGGGCCACCTTTCCCCCCCTTCTCTTCTCCTCCTCC
TTCTTCTTCTTATACTTCTTCTTCTCTTTCCCCCTCGCTGACATACACCTCCCCCACCAATCAAGTTGACCGTCG
CCAACTGCGCCGGAGGCACCAAACGCGCCTTCGCCGCCGCCCTCGTCAGCGGCTCCTTCTCCCTCGGCAACATCA
TCGGCCCCCAGACCTTCCAGGCCCGCGACGCGCCCGACTTCCGTCCCGCCAAGCTCGCCGTCATGGGCACCCAGG
CCGGCTGCGCCTTGGTCACCATTCTTCTCTTCCTCTACTACGTACAGGCCAACCGGCGGCGCAACGACCGCAGCC
GTCAACAGGAGGAGGCCTTCATGTCCCCCGAAGTCTGGGCTACCATGACGGATAAGGAGAATAAGCAGTTTCGGT
ATAGCTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail