Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1664
Gene name
Locationscaffold_160:30663..32085
Strand+
Gene length (bp)1422
Transcript length (bp)1242
Coding sequence length (bp)1239
Protein length (aa) 413

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02868 Peptidase_M4_C Thermolysin metallopeptidase, alpha-helical domain 6.2E-47 243 409
PF01447 Peptidase_M4 Thermolysin metallopeptidase, catalytic domain 9.8E-23 119 239

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A9YWT8|PRTS_PHOAZ Protease PrtS OS=Photorhabdus sp. (strain Az29) GN=prtS PE=1 SV=1 55 412 1.0E-87
sp|Q99132|PRT1_PECCC Extracellular metalloprotease OS=Pectobacterium carotovorum subsp. carotovorum GN=prt1 PE=3 SV=1 60 409 1.0E-87
sp|Q06517|SMP_SERME Extracellular minor metalloprotease OS=Serratia marcescens (strain ATCC 21074 / E-15) GN=smp PE=1 SV=1 54 407 2.0E-50
sp|P68734|NPRE_BACPU Neutral protease NprE OS=Bacillus pumilus GN=nprE PE=1 SV=1 161 409 5.0E-42
sp|P68736|NPRE_BACSU Bacillolysin OS=Bacillus subtilis (strain 168) GN=nprE PE=1 SV=1 161 409 3.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A9YWT8|PRTS_PHOAZ Protease PrtS OS=Photorhabdus sp. (strain Az29) GN=prtS PE=1 SV=1 55 412 1.0E-87
sp|Q99132|PRT1_PECCC Extracellular metalloprotease OS=Pectobacterium carotovorum subsp. carotovorum GN=prt1 PE=3 SV=1 60 409 1.0E-87
sp|Q06517|SMP_SERME Extracellular minor metalloprotease OS=Serratia marcescens (strain ATCC 21074 / E-15) GN=smp PE=1 SV=1 54 407 2.0E-50
sp|P68734|NPRE_BACPU Neutral protease NprE OS=Bacillus pumilus GN=nprE PE=1 SV=1 161 409 5.0E-42
sp|P68736|NPRE_BACSU Bacillolysin OS=Bacillus subtilis (strain 168) GN=nprE PE=1 SV=1 161 409 3.0E-41
sp|P68735|NPRE_BACSA Bacillolysin OS=Bacillus subtilis subsp. amylosacchariticus GN=nprE PE=1 SV=1 161 409 3.0E-41
sp|P06874|NPRT_GEOSE Thermostable neutral protease NprT OS=Geobacillus stearothermophilus GN=nprT PE=1 SV=1 166 409 3.0E-40
sp|P81177|AURE_STAAU Zinc metalloproteinase aureolysin OS=Staphylococcus aureus GN=aur PE=1 SV=2 144 409 5.0E-40
sp|P43133|THER_GEOSE Thermolysin OS=Geobacillus stearothermophilus GN=nprS PE=1 SV=1 171 409 5.0E-40
sp|P23384|NPRE_BACCL Bacillolysin OS=Bacillus caldolyticus GN=npr PE=1 SV=1 128 409 5.0E-40
sp|P00800|THER_BACTH Thermolysin OS=Bacillus thermoproteolyticus GN=npr PE=1 SV=3 171 409 6.0E-40
sp|Q43880|THER_ALIAC Thermolysin OS=Alicyclobacillus acidocaldarius PE=1 SV=1 128 409 9.0E-40
sp|Q59193|THER_BACCL Thermolysin OS=Bacillus caldolyticus GN=npr PE=1 SV=1 128 409 1.0E-39
sp|Q59223|THER_BACSO Thermolysin OS=Bacillus sp. (strain EA1) GN=npr PE=1 SV=1 166 409 1.0E-39
sp|P06832|NPRE_BACAM Bacillolysin OS=Bacillus amyloliquefaciens GN=npr PE=1 SV=1 161 409 2.0E-39
sp|P05806|NPRE_BACCE Bacillolysin OS=Bacillus cereus GN=npr PE=1 SV=2 166 410 3.0E-39
sp|D5DEH5|NPRM_BACMD Bacillolysin OS=Bacillus megaterium (strain DSM 319) GN=nprM PE=3 SV=1 128 409 3.0E-39
sp|P0CH29|NPRM_BACME Bacillolysin OS=Bacillus megaterium GN=nprM PE=1 SV=1 128 409 2.0E-38
sp|P0C0Q3|SEPA_STAEP Extracellular elastase OS=Staphylococcus epidermidis GN=sepA PE=1 SV=1 171 409 2.0E-37
sp|P0C0Q4|SEPA_STAES Extracellular elastase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=sepA PE=3 SV=1 171 409 2.0E-36
sp|P39899|NPRB_BACSU Neutral protease B OS=Bacillus subtilis (strain 168) GN=nprB PE=1 SV=1 161 409 3.0E-36
sp|P29148|NPRE_PAEPO Bacillolysin OS=Paenibacillus polymyxa GN=npr PE=1 SV=1 171 408 4.0E-35
sp|P43263|NPRE_BREBE Bacillolysin OS=Brevibacillus brevis GN=npr PE=1 SV=1 171 409 9.0E-35
sp|P34025|PRTA_LISMN Zinc metalloproteinase OS=Listeria monocytogenes GN=mpl PE=2 SV=3 168 410 2.0E-34
sp|P23224|PRTA_LISMO Zinc metalloproteinase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mpl PE=2 SV=1 168 410 1.0E-33
sp|Q833V7|GELE_ENTFA Gelatinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=gelE PE=1 SV=1 161 412 2.0E-27
sp|P83543|TAMP_STRMB Transglutaminase-activating metalloprotease OS=Streptomyces mobaraensis PE=1 SV=2 171 409 9.0E-21
sp|P55111|PRZN_RENSA Zinc metalloproteinase OS=Renibacterium salmoninarum GN=hly PE=1 SV=2 145 365 5.0E-20
sp|P21347|PROA_LEGPN Zinc metalloproteinase OS=Legionella pneumophila PE=1 SV=1 182 347 1.0E-13
sp|P14756|ELAS_PSEAE Elastase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lasB PE=1 SV=1 156 347 1.0E-13
sp|Q00971|NPRV_VIBPR Neutral protease OS=Vibrio proteolyticus GN=nprV PE=1 SV=1 158 410 2.0E-13
sp|Q02RJ6|ELAS_PSEAB Elastase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=lasB PE=1 SV=1 166 410 2.0E-13
sp|P24153|HAPT_VIBCH Hemagglutinin/proteinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hap PE=1 SV=1 156 410 3.0E-13
sp|P55110|MSPA_LEGLO Zinc metalloproteinase MspA OS=Legionella longbeachae GN=mspA PE=3 SV=1 170 348 4.0E-13
sp|P43147|EMPA_VIBAN Virulence metalloprotease OS=Vibrio anguillarum GN=empA PE=1 SV=1 158 410 1.0E-11
sp|P83913|LIE2_STREX Leupeptin-inactivating enzyme 2 OS=Streptomyces exfoliatus GN=lieB PE=3 SV=1 200 409 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004222 metalloendopeptidase activity Yes
GO:0016787 hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0004175 endopeptidase activity No
GO:0003824 catalytic activity No
GO:0008233 peptidase activity No
GO:0003674 molecular_function No
GO:0008237 metallopeptidase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6411 0.2672 0.5827 0.2276 0.2291 0.2263 0.1665 0.0255 0.0488 0.0993

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4021
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6008
Ophiocordyceps australis map64 (Brazil) OphauB2|1813
Ophiocordyceps camponoti-floridani Ophcf2|01497
Ophiocordyceps camponoti-rufipedis Ophun1|3624
Ophiocordyceps kimflemingae Ophio5|1664 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8082

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1664
MPCPCFIVPPHLLRSIAESTSNPQHVRQAARTSLVAHDRISATRVEVMSQLTDPSSRRGSRPAPFITEAVLARLS
ASEAVDEQVRDHAKRDLNQLQAFMAKPVAQQQGNLAAAEDDKEKHKGNPYRAVYDAKKTMDQDALPGELVRAEGE
GKVKDEDVNLAYDNVGHVLGFYKKHFQWKSIDNKNADVISSVHFGHQFENAFWDPDLMQMVFGDGGEFLGHFTSC
VDVIGHELTHAITEHTSPLQYVDQPGALNEHISDVFGIMVKQLAENETADEADWLVGEGCLLPGVKGTALRSMKS
PGTAYDDPRLGKDPQVASMSEYETTYEDNGGVHIYSGIPNKAFYLAAVAFGGYSWEKAGQIWWKAMNSGRVPSRC
TFQQFADVTVDCATDEFGEEAAKKVRKAWDKVGVSRKV
Coding >Ophio5|1664
ATGCCCTGTCCCTGCTTCATTGTGCCGCCTCACCTCCTTCGCAGCATCGCCGAGTCGACCAGCAATCCGCAGCAT
GTTCGTCAGGCGGCTCGGACCTCCCTCGTCGCTCACGACCGCATCTCTGCCACTCGGGTCGAGGTCATGTCCCAG
CTGACGGATCCCTCGTCCCGACGTGGTAGTCGGCCTGCTCCCTTCATCACCGAAGCTGTCCTTGCCCGGCTTTCG
GCGTCCGAGGCTGTGGACGAGCAAGTTCGCGACCATGCGAAGAGAGATTTGAACCAGCTTCAGGCTTTTATGGCT
AAGCCGGTGGCTCAACAGCAAGGCAACCTTGCCGCTGCCGAGGACGACAAGGAAAAGCACAAGGGCAACCCCTAT
CGTGCCGTGTATGACGCAAAGAAGACAATGGACCAGGATGCTCTGCCTGGCGAGTTGGTGCGAGCTGAAGGCGAA
GGCAAGGTCAAGGACGAAGACGTGAACTTGGCTTACGACAACGTCGGCCACGTCCTGGGCTTCTACAAGAAGCAT
TTCCAGTGGAAGTCCATTGACAACAAAAACGCCGACGTAATCAGCTCGGTCCATTTCGGCCATCAGTTTGAAAAC
GCCTTCTGGGATCCCGACCTGATGCAGATGGTGTTTGGCGACGGCGGCGAGTTCCTCGGCCACTTCACCAGTTGC
GTCGACGTCATCGGACACGAATTGACGCACGCCATCACGGAGCACACCAGCCCCCTCCAGTACGTAGACCAGCCC
GGCGCGCTCAACGAGCACATCTCGGACGTCTTCGGCATCATGGTCAAGCAGCTTGCCGAGAATGAGACGGCCGAC
GAGGCGGACTGGCTCGTCGGTGAAGGATGCCTGCTCCCCGGCGTCAAGGGAACCGCATTACGAAGCATGAAGAGT
CCCGGGACGGCCTACGACGACCCCCGACTGGGGAAAGACCCGCAGGTGGCCAGCATGAGCGAGTACGAGACGACG
TACGAAGACAACGGGGGCGTGCACATCTACTCGGGCATCCCCAACAAGGCCTTTTACCTGGCGGCCGTGGCCTTT
GGCGGCTACTCGTGGGAGAAGGCGGGCCAGATCTGGTGGAAGGCCATGAACAGCGGGCGCGTGCCCTCGCGCTGT
ACCTTTCAGCAGTTTGCCGACGTGACGGTGGACTGTGCCACGGACGAGTTTGGCGAGGAGGCGGCCAAGAAGGTG
CGCAAGGCGTGGGACAAGGTGGGCGTGTCGCGCAAGGTC
Transcript >Ophio5|1664
ATGCCCTGTCCCTGCTTCATTGTGCCGCCTCACCTCCTTCGCAGCATCGCCGAGTCGACCAGCAATCCGCAGCAT
GTTCGTCAGGCGGCTCGGACCTCCCTCGTCGCTCACGACCGCATCTCTGCCACTCGGGTCGAGGTCATGTCCCAG
CTGACGGATCCCTCGTCCCGACGTGGTAGTCGGCCTGCTCCCTTCATCACCGAAGCTGTCCTTGCCCGGCTTTCG
GCGTCCGAGGCTGTGGACGAGCAAGTTCGCGACCATGCGAAGAGAGATTTGAACCAGCTTCAGGCTTTTATGGCT
AAGCCGGTGGCTCAACAGCAAGGCAACCTTGCCGCTGCCGAGGACGACAAGGAAAAGCACAAGGGCAACCCCTAT
CGTGCCGTGTATGACGCAAAGAAGACAATGGACCAGGATGCTCTGCCTGGCGAGTTGGTGCGAGCTGAAGGCGAA
GGCAAGGTCAAGGACGAAGACGTGAACTTGGCTTACGACAACGTCGGCCACGTCCTGGGCTTCTACAAGAAGCAT
TTCCAGTGGAAGTCCATTGACAACAAAAACGCCGACGTAATCAGCTCGGTCCATTTCGGCCATCAGTTTGAAAAC
GCCTTCTGGGATCCCGACCTGATGCAGATGGTGTTTGGCGACGGCGGCGAGTTCCTCGGCCACTTCACCAGTTGC
GTCGACGTCATCGGACACGAATTGACGCACGCCATCACGGAGCACACCAGCCCCCTCCAGTACGTAGACCAGCCC
GGCGCGCTCAACGAGCACATCTCGGACGTCTTCGGCATCATGGTCAAGCAGCTTGCCGAGAATGAGACGGCCGAC
GAGGCGGACTGGCTCGTCGGTGAAGGATGCCTGCTCCCCGGCGTCAAGGGAACCGCATTACGAAGCATGAAGAGT
CCCGGGACGGCCTACGACGACCCCCGACTGGGGAAAGACCCGCAGGTGGCCAGCATGAGCGAGTACGAGACGACG
TACGAAGACAACGGGGGCGTGCACATCTACTCGGGCATCCCCAACAAGGCCTTTTACCTGGCGGCCGTGGCCTTT
GGCGGCTACTCGTGGGAGAAGGCGGGCCAGATCTGGTGGAAGGCCATGAACAGCGGGCGCGTGCCCTCGCGCTGT
ACCTTTCAGCAGTTTGCCGACGTGACGGTGGACTGTGCCACGGACGAGTTTGGCGAGGAGGCGGCCAAGAAGGTG
CGCAAGGCGTGGGACAAGGTGGGCGTGTCGCGCAAGGTCTAG
Gene >Ophio5|1664
ATGCCCTGTCCCTGCTTCATTGTGCCGCCTCACCTCCTTCGCAGCATCGCCGAGTCGACCAGCAATCCGCAGCAT
GTTCGTCAGGCGGCTCGGACCTCCCTCGTCGCTCACGACCGCATCTCTGCCACTCGGGTCGAGGTCATGTCCCAG
CTGACGGATCCCTCGTCCCGACGTGGTAGTCGGCCTGCTCCCTTCATCACCGAAGCTGTCCTTGCCCGGCTTTCG
GCGTCCGAGGCTGTGGACGAGCAAGTTCGCGACCATGCGAAGAGAGATTTGAACCAGCTTCAGGCTTTTATGGCT
AAGCCGGTGGCTCAACAGCAAGGCAAGTGATGAGGCATCGCTCGATGGAGACGCCTCGCTGATTTTAAAATTTCT
CTCTCATGAATAGCCAGCCTTGCCGCTGCCGAGGACGACAAGGAAAAGCACAAGGGCAACCCCTATCGTGCCGTG
TATGACGCAAAGAAGACAATGGACCAGGATGCTCTGCCTGGCGAGTTGGTGCGAGCTGAAGGCGAAGGCAAGGTC
AAGGACGAAGACGTGAACTTGGCTTACGACAACGTCGGCCACGTCCTGGGCTTCTACAAGAAGCATTTCCAGTGG
AAGTCCATTGACAACAAAAACGCCGACGTAATCAGCTCGGTCCATTTCGGCCATCAGTTTGAAAACGCCTGTGAG
TCCCGTATCGGTTCTTGCAAAAAACGAGGTCCGCGACGCTGACGGCCGTTCAGTCTGGGATCCCGACCTGATGCA
GATGGTGTTTGGCGACGGCGGCGAGTTCCTCGGCCACTTCACCAGTTGCGTCGACGTCATCGGACACGAATTGAC
GCACGCCATCACGGAGCACACCAGCCCCCTCCAGTACGTAGACCAGCCCGGCGCGCTCAACGAGCACATCTCGGA
CGTCTTCGGCATCATGGTCAAGCAGCTTGCCGAGAATGAGACGGCCGACGAGGCGGACTGGCTCGTCGGTGAAGG
ATGCCTGCTCCCCGGCGTCAAGGGAACCGCATTACGAAGCATGAAGAGTCCCGGGACGGCCTACGACGACCCCCG
ACTGGTAAGCAGCGCCGGAAGCCGGAGCGCGGCGAAGCCCCGGCTGACTTGTCATGACAGGGGAAAGACCCGCAG
GTGGCCAGCATGAGCGAGTACGAGACGACGTACGAAGACAACGGGGGCGTGCACATCTACTCGGGCATCCCCAAC
AAGGCCTTTTACCTGGCGGCCGTGGCCTTTGGCGGCTACTCGTGGGAGAAGGCGGGCCAGATCTGGTGGAAGGCC
ATGAACAGCGGGCGCGTGCCCTCGCGCTGTACCTTTCAGCAGTTTGCCGACGTGACGGTGGACTGTGCCACGGAC
GAGTTTGGCGAGGAGGCGGCCAAGAAGGTGCGCAAGGCGTGGGACAAGGTGGGCGTGTCGCGCAAGGTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail