Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1649
Gene name
Locationscaffold_16:85509..87167
Strand-
Gene length (bp)1658
Transcript length (bp)1602
Coding sequence length (bp)1599
Protein length (aa) 533

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 1.8E-49 36 364
PF11954 DUF3471 Domain of unknown function (DUF3471) 3.0E-12 429 528

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06317|PBP4_AMYLA Penicillin-binding protein 4 OS=Amycolatopsis lactamdurans GN=pbp PE=3 SV=1 41 380 3.0E-12
sp|P00811|AMPC_ECOLI Beta-lactamase OS=Escherichia coli (strain K12) GN=ampC PE=1 SV=1 39 362 5.0E-12
sp|P32959|PBPE_BACSU Penicillin-binding protein 4* OS=Bacillus subtilis (strain 168) GN=pbpE PE=1 SV=1 42 343 2.0E-11
sp|P24735|AMPC_PSEAE Beta-lactamase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ampC PE=1 SV=2 22 383 3.0E-11
sp|O31773|PBPX_BACSU Putative penicillin-binding protein PbpX OS=Bacillus subtilis (strain 168) GN=pbpX PE=2 SV=1 31 378 5.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06317|PBP4_AMYLA Penicillin-binding protein 4 OS=Amycolatopsis lactamdurans GN=pbp PE=3 SV=1 41 380 3.0E-12
sp|P00811|AMPC_ECOLI Beta-lactamase OS=Escherichia coli (strain K12) GN=ampC PE=1 SV=1 39 362 5.0E-12
sp|P32959|PBPE_BACSU Penicillin-binding protein 4* OS=Bacillus subtilis (strain 168) GN=pbpE PE=1 SV=1 42 343 2.0E-11
sp|P24735|AMPC_PSEAE Beta-lactamase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ampC PE=1 SV=2 22 383 3.0E-11
sp|O31773|PBPX_BACSU Putative penicillin-binding protein PbpX OS=Bacillus subtilis (strain 168) GN=pbpX PE=2 SV=1 31 378 5.0E-10
sp|A5VVL2|DAP_BRUO2 D-aminopeptidase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dap PE=3 SV=1 33 372 7.0E-09
sp|P05193|AMPC_CITFR Beta-lactamase OS=Citrobacter freundii GN=ampC PE=1 SV=1 39 280 8.0E-09
sp|Q2YLB4|DAP_BRUA2 D-aminopeptidase OS=Brucella abortus (strain 2308) GN=dap PE=3 SV=1 33 372 1.0E-08
sp|B2SD81|DAP_BRUA1 D-aminopeptidase OS=Brucella abortus (strain S19) GN=dap PE=3 SV=1 33 372 1.0E-08
sp|Q579G4|DAP_BRUAB D-aminopeptidase OS=Brucella abortus biovar 1 (strain 9-941) GN=dap PE=3 SV=1 33 372 1.0E-08
sp|A9MCM7|DAP_BRUC2 D-aminopeptidase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=dap PE=3 SV=1 33 372 1.0E-08
sp|A9WVV8|DAP_BRUSI D-aminopeptidase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=dap PE=3 SV=1 33 372 1.0E-08
sp|Q8FV99|DAP_BRUSU D-aminopeptidase OS=Brucella suis biovar 1 (strain 1330) GN=dap PE=3 SV=1 33 372 1.0E-08
sp|Q8YD27|DAP_BRUME D-aminopeptidase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dap PE=3 SV=1 33 372 2.0E-08
sp|C0RM93|DAP_BRUMB D-aminopeptidase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=dap PE=3 SV=1 33 372 2.0E-08
sp|A6WYS5|DAP_OCHA4 D-aminopeptidase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=dap PE=3 SV=1 27 346 2.0E-08
sp|P85302|AMPC_PSEFL Beta-lactamase OS=Pseudomonas fluorescens GN=ampC PE=1 SV=1 39 326 4.0E-08
sp|P05364|AMPC_ENTCL Beta-lactamase OS=Enterobacter cloacae GN=ampC PE=1 SV=1 39 285 2.0E-07
sp|P18539|AMPC_SERMA Beta-lactamase OS=Serratia marcescens GN=ampC PE=3 SV=1 34 225 2.0E-07
sp|P45460|AMPC_YEREN Beta-lactamase OS=Yersinia enterocolitica GN=ampC PE=3 SV=1 42 367 3.0E-07
sp|Q48743|AMPC_LYSLA Beta-lactamase OS=Lysobacter lactamgenus PE=3 SV=1 39 246 3.0E-07
sp|O69773|AMPC_PROST Beta-lactamase OS=Providencia stuartii GN=ampC PE=3 SV=1 39 360 1.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.8326 0.297 0.1468 0.1085 0.0969 0.0451 0.3358 0.1332 0.2936 0.0241

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup111
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|115
Ophiocordyceps camponoti-floridani Ophcf2|03858
Ophiocordyceps camponoti-floridani Ophcf2|05282
Ophiocordyceps camponoti-rufipedis Ophun1|4044
Ophiocordyceps camponoti-rufipedis Ophun1|7452
Ophiocordyceps kimflemingae Ophio5|1649 (this protein)
Ophiocordyceps kimflemingae Ophio5|4067
Ophiocordyceps subramaniannii Hirsu2|1745
Ophiocordyceps subramaniannii Hirsu2|1988
Ophiocordyceps subramaniannii Hirsu2|230
Ophiocordyceps subramaniannii Hirsu2|2822
Ophiocordyceps subramaniannii Hirsu2|5585

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1649
MDAVASSSSSSPSPPLQLQPASGDAVMDLFRSPDFSAYVKKLIERHHVPGLAIAIVQDGQVASAAYGKASLDPPR
DFGTDTLFCVGSSAKSLTAASVGVLVEDNDKYPQVQFDTPMSSLLPGDFVMPGKDHDHVTVEDVLCHRTGMAPHE
YSILGPRAKTPDDPRSLTRNLRNLSVMAPNRAEHIYCNMLYTTMTYMIERVSGMTFYDFMCKNIFEPLGMKSTYL
LMDRVRERGLEDRVATGYAWEKGKHREMVTCDGPEAEGAGQIYSTIDDYVKWVKAMLRHEGPITENLATALTTKR
IQQDPEQDPEQESCAFYALGWQVHQYSGYKIVSHDGGEPGFQCNHFFIPELDFGGVIFSNADEADTVVSLLMYRM
IDEVAQKGSDGRVVREEGLGSESESESESVSDEDEDDDGLEEELRQELSPGLEKPEPQKMPLSTYTGHYSHPGYH
DLTVEVKDGALFIDATDRSYGFTLVFKHICEQTKYIGYMMQSFETSDLPIKAEFRLEGDRAVKLGLHLQDRVDDY
IWFDRVDG
Coding >Ophio5|1649
ATGGACGCCGTTGCCTCATCCTCTTCCTCTTCCCCCTCTCCCCCCTTGCAGCTGCAGCCTGCCTCAGGAGACGCC
GTCATGGACCTTTTCCGCTCTCCCGACTTCTCCGCCTACGTCAAGAAGCTCATCGAGCGCCATCATGTGCCCGGG
CTGGCCATTGCCATCGTCCAAGACGGCCAGGTCGCCTCGGCCGCATACGGAAAGGCATCACTGGATCCTCCGCGG
GACTTTGGCACCGATACGCTCTTCTGCGTCGGCTCTTCTGCAAAGTCGCTGACGGCCGCGTCCGTGGGCGTGCTG
GTGGAAGACAATGACAAGTATCCCCAGGTGCAGTTCGACACGCCCATGTCGAGCCTTCTGCCGGGCGACTTCGTC
ATGCCAGGGAAGGATCACGACCATGTCACCGTCGAAGACGTGCTTTGCCACCGGACCGGCATGGCCCCGCATGAA
TACTCCATCCTCGGCCCTCGAGCGAAGACGCCGGACGACCCGCGTTCCCTAACAAGAAATCTGCGGAATCTCTCT
GTCATGGCGCCGAACCGTGCCGAGCATATCTACTGCAATATGCTGTACACGACCATGACCTACATGATTGAACGT
GTCAGCGGCATGACCTTTTACGACTTCATGTGCAAGAACATCTTCGAGCCTCTCGGCATGAAGTCGACCTACCTT
CTGATGGACCGAGTTCGGGAAAGGGGGCTGGAGGACAGAGTCGCCACCGGCTACGCGTGGGAAAAGGGCAAGCAT
CGCGAGATGGTGACCTGCGACGGCCCCGAGGCTGAGGGGGCAGGCCAGATCTACTCGACCATCGACGACTACGTA
AAATGGGTCAAGGCCATGCTTCGGCACGAGGGTCCCATCACGGAGAATTTGGCGACAGCGCTAACGACGAAACGC
ATACAGCAGGACCCTGAGCAGGATCCCGAGCAAGAGTCGTGTGCGTTTTACGCCCTCGGGTGGCAGGTCCACCAA
TATAGCGGCTACAAGATTGTGTCGCATGATGGTGGCGAGCCCGGCTTCCAGTGCAACCACTTCTTCATCCCTGAG
CTCGACTTTGGTGGCGTAATCTTCAGCAACGCGGACGAGGCCGATACGGTGGTGAGCCTCCTGATGTACCGGATG
ATTGACGAAGTGGCACAAAAGGGCAGCGACGGAAGGGTGGTCCGCGAGGAAGGACTCGGGTCCGAGTCCGAGTCC
GAGTCAGAGTCGGTCTCGGACGAGGACGAGGATGACGACGGGCTGGAGGAGGAGCTTCGCCAGGAGCTCAGCCCC
GGCCTCGAAAAGCCCGAGCCGCAGAAGATGCCGCTGAGCACCTATACGGGACACTACTCGCACCCTGGCTATCAT
GACCTCACGGTCGAAGTCAAGGACGGCGCGCTCTTCATCGACGCCACAGACCGATCATACGGCTTCACGCTCGTC
TTTAAGCACATCTGCGAGCAGACCAAATACATCGGCTACATGATGCAGTCTTTCGAGACCAGCGACCTTCCCATC
AAGGCCGAGTTCCGGCTCGAGGGAGACAGAGCCGTCAAGCTGGGTCTGCACCTTCAGGATCGCGTCGACGATTAC
ATCTGGTTTGATCGCGTCGACGGC
Transcript >Ophio5|1649
ATGGACGCCGTTGCCTCATCCTCTTCCTCTTCCCCCTCTCCCCCCTTGCAGCTGCAGCCTGCCTCAGGAGACGCC
GTCATGGACCTTTTCCGCTCTCCCGACTTCTCCGCCTACGTCAAGAAGCTCATCGAGCGCCATCATGTGCCCGGG
CTGGCCATTGCCATCGTCCAAGACGGCCAGGTCGCCTCGGCCGCATACGGAAAGGCATCACTGGATCCTCCGCGG
GACTTTGGCACCGATACGCTCTTCTGCGTCGGCTCTTCTGCAAAGTCGCTGACGGCCGCGTCCGTGGGCGTGCTG
GTGGAAGACAATGACAAGTATCCCCAGGTGCAGTTCGACACGCCCATGTCGAGCCTTCTGCCGGGCGACTTCGTC
ATGCCAGGGAAGGATCACGACCATGTCACCGTCGAAGACGTGCTTTGCCACCGGACCGGCATGGCCCCGCATGAA
TACTCCATCCTCGGCCCTCGAGCGAAGACGCCGGACGACCCGCGTTCCCTAACAAGAAATCTGCGGAATCTCTCT
GTCATGGCGCCGAACCGTGCCGAGCATATCTACTGCAATATGCTGTACACGACCATGACCTACATGATTGAACGT
GTCAGCGGCATGACCTTTTACGACTTCATGTGCAAGAACATCTTCGAGCCTCTCGGCATGAAGTCGACCTACCTT
CTGATGGACCGAGTTCGGGAAAGGGGGCTGGAGGACAGAGTCGCCACCGGCTACGCGTGGGAAAAGGGCAAGCAT
CGCGAGATGGTGACCTGCGACGGCCCCGAGGCTGAGGGGGCAGGCCAGATCTACTCGACCATCGACGACTACGTA
AAATGGGTCAAGGCCATGCTTCGGCACGAGGGTCCCATCACGGAGAATTTGGCGACAGCGCTAACGACGAAACGC
ATACAGCAGGACCCTGAGCAGGATCCCGAGCAAGAGTCGTGTGCGTTTTACGCCCTCGGGTGGCAGGTCCACCAA
TATAGCGGCTACAAGATTGTGTCGCATGATGGTGGCGAGCCCGGCTTCCAGTGCAACCACTTCTTCATCCCTGAG
CTCGACTTTGGTGGCGTAATCTTCAGCAACGCGGACGAGGCCGATACGGTGGTGAGCCTCCTGATGTACCGGATG
ATTGACGAAGTGGCACAAAAGGGCAGCGACGGAAGGGTGGTCCGCGAGGAAGGACTCGGGTCCGAGTCCGAGTCC
GAGTCAGAGTCGGTCTCGGACGAGGACGAGGATGACGACGGGCTGGAGGAGGAGCTTCGCCAGGAGCTCAGCCCC
GGCCTCGAAAAGCCCGAGCCGCAGAAGATGCCGCTGAGCACCTATACGGGACACTACTCGCACCCTGGCTATCAT
GACCTCACGGTCGAAGTCAAGGACGGCGCGCTCTTCATCGACGCCACAGACCGATCATACGGCTTCACGCTCGTC
TTTAAGCACATCTGCGAGCAGACCAAATACATCGGCTACATGATGCAGTCTTTCGAGACCAGCGACCTTCCCATC
AAGGCCGAGTTCCGGCTCGAGGGAGACAGAGCCGTCAAGCTGGGTCTGCACCTTCAGGATCGCGTCGACGATTAC
ATCTGGTTTGATCGCGTCGACGGCTGA
Gene >Ophio5|1649
ATGGACGCCGTTGCCTCATCCTCTTCCTCTTCCCCCTCTCCCCCCTTGCAGCTGCAGCCTGCCTCAGGAGACGCC
GTCATGGACCTTTTCCGCTCTCCCGACTTCTCCGCCTACGTCAAGAAGCTCATCGAGCGCCATCATGTGCCCGGG
CTGGCCATTGCCATCGTCCAAGACGGCCAGGTCGCCTCGGCCGCATACGGAAAGGCATCACTGGATCCTCCGCGG
GACTTTGGCACCGATACGCTCTTCTGCGTCGGCTCTTCTGCAAAGTCGCTGACGGCCGCGTCCGTGGGCGTGCTG
GTGGAAGACAATGACAAGTATCCCCAGGTGCAGTTCGACACGCCCATGTCGAGCCTTCTGCCGGGCGACTTCGTC
ATGCCAGGGAAGGATCACGACCATGTCACCGTCGAAGACGTGCTTTGCCACCGGACCGGCATGGCCCCGTGAGTC
TTGCTCAAGCCCACTGTAAGATTCAGGTGCTGACAGGCTCCCCTGATAGGCATGAATACTCCATCCTCGGCCCTC
GAGCGAAGACGCCGGACGACCCGCGTTCCCTAACAAGAAATCTGCGGAATCTCTCTGTCATGGCGCCGAACCGTG
CCGAGCATATCTACTGCAATATGCTGTACACGACCATGACCTACATGATTGAACGTGTCAGCGGCATGACCTTTT
ACGACTTCATGTGCAAGAACATCTTCGAGCCTCTCGGCATGAAGTCGACCTACCTTCTGATGGACCGAGTTCGGG
AAAGGGGGCTGGAGGACAGAGTCGCCACCGGCTACGCGTGGGAAAAGGGCAAGCATCGCGAGATGGTGACCTGCG
ACGGCCCCGAGGCTGAGGGGGCAGGCCAGATCTACTCGACCATCGACGACTACGTAAAATGGGTCAAGGCCATGC
TTCGGCACGAGGGTCCCATCACGGAGAATTTGGCGACAGCGCTAACGACGAAACGCATACAGCAGGACCCTGAGC
AGGATCCCGAGCAAGAGTCGTGTGCGTTTTACGCCCTCGGGTGGCAGGTCCACCAATATAGCGGCTACAAGATTG
TGTCGCATGATGGTGGCGAGCCCGGCTTCCAGTGCAACCACTTCTTCATCCCTGAGCTCGACTTTGGTGGCGTAA
TCTTCAGCAACGCGGACGAGGCCGATACGGTGGTGAGCCTCCTGATGTACCGGATGATTGACGAAGTGGCACAAA
AGGGCAGCGACGGAAGGGTGGTCCGCGAGGAAGGACTCGGGTCCGAGTCCGAGTCCGAGTCAGAGTCGGTCTCGG
ACGAGGACGAGGATGACGACGGGCTGGAGGAGGAGCTTCGCCAGGAGCTCAGCCCCGGCCTCGAAAAGCCCGAGC
CGCAGAAGATGCCGCTGAGCACCTATACGGGACACTACTCGCACCCTGGCTATCATGACCTCACGGTCGAAGTCA
AGGACGGCGCGCTCTTCATCGACGCCACAGACCGATCATACGGCTTCACGCTCGTCTTTAAGCACATCTGCGAGC
AGACCAAATACATCGGCTACATGATGCAGTCTTTCGAGACCAGCGACCTTCCCATCAAGGCCGAGTTCCGGCTCG
AGGGAGACAGAGCCGTCAAGCTGGGTCTGCACCTTCAGGATCGCGTCGACGATTACATCTGGTTTGATCGCGTCG
ACGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail