Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1644
Gene name
Locationscaffold_16:73996..75694
Strand-
Gene length (bp)1698
Transcript length (bp)1524
Coding sequence length (bp)1521
Protein length (aa) 507

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.2E-19 101 452

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.5

Transmembrane Domains

Domain # Start End Length
1 131 153 22
2 163 185 22
3 198 220 22
4 225 244 19
5 292 314 22
6 344 366 22
7 378 400 22
8 404 426 22
9 438 460 22
10 470 492 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.0 0.0 0.00
CcL In ants, during behavior modification 0.2 0.0 0.55
CcD In ants, recently dead 0.0 0.0 0.00

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 1.0 no
SC16a CcD 1.0 no
CcL CcD 1.0 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1644
MATFPPINDDEFQEETPLLSTNARPSVSSSVSLRRRVIATCALFLFIVEVSSFVMEPSTLQIVEDIICRNHYPDH
KLGMPIVDRRCKDTSVQKTLAMIRSWSMSADMLIRPALVVQFPFGIMADKYGRRTVLILAFVGCVLQTSWVILVL
QLPDIFSVWSLLYGSAAYAIGGGGQMAGAMIWTIVTDVTPVANRTTVFYQLQAFYLLLAVLSNSLAAFLLSIDPW
IGMWLGFGTLLLSVSAACLIPETLHLRHQVDTRHDSPQENGVGENLTTDKGSCISQAWAAVRHDAGHVWRFIFAS
RSIVTLILAYGLFIPSKLGIKLNILQYMTRRFGWEWSTATYISTVSNITSVVVLLVILPSISAILVRRRTYNPLE
RDLLLSRVSSALVVVGGFMLAFAAVRWLFISSLVIISLGVGFGVLCRALLNTLVEPHTVATVNTTISMVETVVSL
AGAPALGWLLSCGLEAGGPWLGLSFLVSAGFCTLAYLAISIYRVPAGTPDTRETPTR
Coding >Ophio5|1644
ATGGCGACTTTCCCCCCTATCAACGACGACGAGTTTCAAGAGGAGACGCCTCTTCTCAGCACAAATGCGCGGCCC
AGCGTAAGCTCCAGTGTGTCGCTTCGGCGCCGCGTCATCGCCACCTGCGCCCTGTTCCTCTTCATCGTTGAGGTG
AGCAGCTTCGTCATGGAGCCGTCGACGCTGCAGATTGTGGAGGACATCATTTGCCGAAACCATTATCCGGACCAC
AAGCTGGGCATGCCGATTGTCGACAGACGCTGCAAAGACACGAGCGTTCAGAAGACACTGGCCATGATTCGATCT
TGGTCCATGTCGGCCGACATGCTCATCCGCCCAGCCCTCGTTGTTCAGTTTCCCTTTGGCATCATGGCCGACAAG
TACGGCCGTCGGACGGTCTTGATATTGGCCTTTGTTGGATGCGTCCTGCAGACATCCTGGGTCATCTTGGTCTTG
CAGCTGCCCGACATCTTCTCCGTCTGGAGCTTATTGTACGGCAGCGCCGCATATGCCATAGGCGGAGGAGGCCAA
ATGGCCGGTGCCATGATTTGGACCATTGTGACGGATGTTACCCCCGTCGCCAACCGCACAACCGTCTTCTACCAG
CTTCAAGCCTTTTATCTGCTTCTCGCCGTACTTTCCAACTCATTGGCCGCCTTCCTCCTCAGCATCGACCCCTGG
ATCGGCATGTGGCTTGGATTCGGCACCCTCCTCCTCAGCGTGTCAGCCGCCTGTCTGATTCCAGAAACTCTGCAC
CTGCGCCACCAAGTCGACACACGACATGACTCTCCACAAGAGAATGGTGTAGGGGAGAACCTGACGACGGACAAA
GGAAGTTGCATCTCGCAAGCTTGGGCAGCCGTCAGACATGATGCTGGTCATGTTTGGCGCTTCATCTTTGCTTCG
AGGAGCATCGTCACTCTCATACTGGCCTATGGCCTTTTCATCCCGTCCAAACTCGGCATAAAACTGAACATTCTC
CAATACATGACGAGACGATTCGGATGGGAGTGGTCAACGGCCACCTACATCTCTACAGTCAGCAACATAACCTCT
GTCGTTGTGCTGCTGGTGATATTACCTTCCATCTCTGCCATACTTGTCAGGCGTCGCACCTACAACCCTCTGGAG
CGGGACCTTTTGCTGAGCCGCGTGTCCTCGGCACTCGTCGTCGTGGGCGGCTTCATGCTAGCCTTTGCCGCTGTG
CGATGGTTGTTCATCTCATCTCTCGTCATCATCAGCCTCGGAGTAGGCTTCGGTGTGCTGTGCCGCGCCTTGCTC
AACACCCTCGTCGAACCGCACACAGTTGCAACCGTCAACACCACGATATCCATGGTGGAAACGGTCGTGAGTCTC
GCTGGAGCCCCGGCGCTAGGTTGGCTTCTCAGCTGCGGGTTAGAAGCTGGCGGTCCTTGGCTCGGACTTTCGTTC
CTCGTGTCCGCTGGCTTTTGCACCCTGGCGTATCTTGCCATTTCCATTTATAGGGTTCCTGCTGGGACGCCTGAT
ACAAGGGAGACGCCCACAAGA
Transcript >Ophio5|1644
ATGGCGACTTTCCCCCCTATCAACGACGACGAGTTTCAAGAGGAGACGCCTCTTCTCAGCACAAATGCGCGGCCC
AGCGTAAGCTCCAGTGTGTCGCTTCGGCGCCGCGTCATCGCCACCTGCGCCCTGTTCCTCTTCATCGTTGAGGTG
AGCAGCTTCGTCATGGAGCCGTCGACGCTGCAGATTGTGGAGGACATCATTTGCCGAAACCATTATCCGGACCAC
AAGCTGGGCATGCCGATTGTCGACAGACGCTGCAAAGACACGAGCGTTCAGAAGACACTGGCCATGATTCGATCT
TGGTCCATGTCGGCCGACATGCTCATCCGCCCAGCCCTCGTTGTTCAGTTTCCCTTTGGCATCATGGCCGACAAG
TACGGCCGTCGGACGGTCTTGATATTGGCCTTTGTTGGATGCGTCCTGCAGACATCCTGGGTCATCTTGGTCTTG
CAGCTGCCCGACATCTTCTCCGTCTGGAGCTTATTGTACGGCAGCGCCGCATATGCCATAGGCGGAGGAGGCCAA
ATGGCCGGTGCCATGATTTGGACCATTGTGACGGATGTTACCCCCGTCGCCAACCGCACAACCGTCTTCTACCAG
CTTCAAGCCTTTTATCTGCTTCTCGCCGTACTTTCCAACTCATTGGCCGCCTTCCTCCTCAGCATCGACCCCTGG
ATCGGCATGTGGCTTGGATTCGGCACCCTCCTCCTCAGCGTGTCAGCCGCCTGTCTGATTCCAGAAACTCTGCAC
CTGCGCCACCAAGTCGACACACGACATGACTCTCCACAAGAGAATGGTGTAGGGGAGAACCTGACGACGGACAAA
GGAAGTTGCATCTCGCAAGCTTGGGCAGCCGTCAGACATGATGCTGGTCATGTTTGGCGCTTCATCTTTGCTTCG
AGGAGCATCGTCACTCTCATACTGGCCTATGGCCTTTTCATCCCGTCCAAACTCGGCATAAAACTGAACATTCTC
CAATACATGACGAGACGATTCGGATGGGAGTGGTCAACGGCCACCTACATCTCTACAGTCAGCAACATAACCTCT
GTCGTTGTGCTGCTGGTGATATTACCTTCCATCTCTGCCATACTTGTCAGGCGTCGCACCTACAACCCTCTGGAG
CGGGACCTTTTGCTGAGCCGCGTGTCCTCGGCACTCGTCGTCGTGGGCGGCTTCATGCTAGCCTTTGCCGCTGTG
CGATGGTTGTTCATCTCATCTCTCGTCATCATCAGCCTCGGAGTAGGCTTCGGTGTGCTGTGCCGCGCCTTGCTC
AACACCCTCGTCGAACCGCACACAGTTGCAACCGTCAACACCACGATATCCATGGTGGAAACGGTCGTGAGTCTC
GCTGGAGCCCCGGCGCTAGGTTGGCTTCTCAGCTGCGGGTTAGAAGCTGGCGGTCCTTGGCTCGGACTTTCGTTC
CTCGTGTCCGCTGGCTTTTGCACCCTGGCGTATCTTGCCATTTCCATTTATAGGGTTCCTGCTGGGACGCCTGAT
ACAAGGGAGACGCCCACAAGATAA
Gene >Ophio5|1644
ATGGCGACTTTCCCCCCTATCAACGACGACGAGTTTCAAGAGGAGACGCCTCTTCTCAGCACAAATGCGCGGCCC
AGCGTAAGCTCCAGTGTGTCGCTTCGGCGCCGCGTCATCGCCACCTGCGCCCTGTTCCTCTTCATCGTTGAGGTG
AGCAGCTTCGTCATGGAGCCGTCGACGCTGCAGATTGTGGAGGACATCATTTGCCGAAACCATTATCCGGACCAC
AAGCTGGGCATGCCGATTGTCGACAGACGCTGCAAAGACACGAGCGTTCAGAAGACACTGGCCATGATTCGATCT
TGGTCCATGTCGGCCGACATGCTCATCCGTACGTCGAGCCTCTGATGGCGGAAATCTTGCCTGTCGTTGACTTCA
GGCCCAGCCCTCGTTGTTCAGTTTCCCTTTGGCATCATGGCCGACAAGTACGGCCGTCGGACGGTCTTGATATTG
GCCTTTGTTGGATGCGTCCTGCAGACATCCTGGGTCATCTTGGTCTGTGAGTATAGGCAGCCATCGACGACTTCT
CTGACCTGACTTGAACGCCTCGACTAGTGCAGCTGCCCGACATCTTCTCCGTCTGGAGCTTATTGTACGGCAGCG
CCGCATATGCCATAGGCGGAGGAGGCCAAATGGCCGGTGCCATGATTTGGACCATTGTGACGGATGTTACCCCCG
TCGCCAACCGCACAACCGTCTTCTACCAGCTTCAAGCCTTTTATCTGCTTCTCGCCGTACTTTCCAACTCATTGG
CCGCCTTCCTCCTCAGCATCGACCCCTGGATCGGCATGTGGCTTGGATTCGGCACCCTCCTCCTCAGCGTGTCAG
CCGCCTGTCTGATTCCAGAAACTCTGCACCTGCGCCACCAAGTCGACACACGACATGACTCTCCACAAGAGAATG
GTGTAGGGGAGAACCTGACGACGGACAAAGGAAGTTGCATCTCGCAAGCTTGGGCAGCCGTCAGACATGATGCTG
GTCATGTTTGGCGCTTCATCTTTGCTTCGAGGAGCATCGTCACTCTCATACTGGCCTATGGCCTTTTCATCCCGT
CCAAACTCGGCATAAAACTGAACATTCTCCAATACATGACGAGACGATTCGGATGGGAGTGGTCAACGGTCAGGC
TCCCCTGTTCAATCCAAGATGGAAACCCCCTTCTTTATAGCGGCATGTGCTCACGCTTTTCAGGCCACCTACATC
TCTACAGTCAGCAACATAACCTCTGTCGTTGTGCTGCTGGTGATATTACCTTCCATCTCTGCCATACTTGTCAGG
CGTCGCACCTACAACCCTCTGGAGCGGGACCTTTTGCTGAGCCGCGTGTCCTCGGCACTCGTCGTCGTGGGCGGC
TTCATGCTAGCCTTTGCCGCTGTGCGATGGTTGTTCATCTCATCTCTCGTCATCATCAGCCTCGGAGTAGGCTTC
GGTGTGCTGTGCCGCGCCTTGCTCAACACCCTCGTCGAACCGCACACAGTTGCAACCGTCAACACCACGATATCC
ATGGTGGAAACGGTCGTGAGTCTCGCTGGAGCCCCGGCGCTAGGTTGGCTTCTCAGCTGCGGGTTAGAAGCTGGC
GGTCCTTGGCTCGGACTTTCGTTCCTCGTGTCCGCTGGCTTTTGCACCCTGGCGTATCTTGCCATTTCCATTTAT
AGGGTTCCTGCTGGGACGCCTGATACAAGGGAGACGCCCACAAGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail