Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1641
Gene name
Locationscaffold_16:62573..64627
Strand-
Gene length (bp)2054
Transcript length (bp)1776
Coding sequence length (bp)1773
Protein length (aa) 591

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 8.8E-23 119 266
PF08031 BBE Berberine and berberine like 3.3E-09 533 569

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 25 577 1.0E-62
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 10 589 1.0E-55
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 119 334 9.0E-16
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 122 308 3.0E-11
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 122 308 5.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 25 577 1.0E-62
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 10 589 1.0E-55
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 119 334 9.0E-16
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 122 308 3.0E-11
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 122 308 5.0E-11
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 122 308 4.0E-10
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 118 591 4.0E-09
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 122 308 5.0E-09
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 70 299 1.0E-08
sp|Q5JLP4|CKX4_ORYSJ Cytokinin dehydrogenase 4 OS=Oryza sativa subsp. japonica GN=CKX4 PE=2 SV=1 118 568 3.0E-08
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 72 303 6.0E-08
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 119 304 6.0E-08
sp|Q9FZC5|FOX2_ARATH Flavin-dependent oxidoreductase FOX2 OS=Arabidopsis thaliana GN=FOX2 PE=2 SV=1 122 308 1.0E-07
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 139 308 1.0E-07
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 228 301 2.0E-07
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 119 334 2.0E-07
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 148 308 3.0E-07
sp|P93479|RETO_PAPSO Reticuline oxidase OS=Papaver somniferum GN=BBE1 PE=2 SV=1 198 568 3.0E-07
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 70 299 5.0E-07
sp|Q9T0N8|CKX1_MAIZE Cytokinin dehydrogenase 1 OS=Zea mays GN=CKX1 PE=1 SV=2 145 300 2.0E-06
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 198 311 2.0E-06
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 70 299 3.0E-06
sp|P10867|GGLO_RAT L-gulonolactone oxidase OS=Rattus norvegicus GN=Gulo PE=1 SV=3 196 299 3.0E-06
sp|Q75K78|CKX9_ORYSJ Cytokinin dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CKX9 PE=2 SV=1 118 568 7.0E-06
sp|Q0JQ12|CKX1_ORYSJ Cytokinin dehydrogenase 1 OS=Oryza sativa subsp. japonica GN=CKX1 PE=3 SV=2 141 331 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 5 24 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1641
MATRTLLLALCCLFSLLGFASGTTRHCKAFPGGRDWPSKESWHGFNRTLGGRLLAPRPPGTVCHRDQPTYSPTQC
PNVQRLWTTFEFHAQNPVSVVWNQWTGFDCLPDATTPCSGKGYPPYVVDASNAKHVKLAVDFARTRNVRLVVKNT
GYDFLGRSTAPGALSIWTLHMNSIQYHPKGQFKLSGSRRPFRGNAVTVGAGALTNDIYRALDKYGQLFIGAMGPT
VGIAGYLSSGGHSNLSGRYGLGADTVLEMEVVTPEGEILTVNEHCHRDLFWALRGGGGSTFGVVTKITMQTYPSP
KVLGIHWVVGIEAQDARASELAPDLLSKLPDAIDAGLLGWTAIADNVLNPVPVAGSPVAGNVSGLYGVNAVLDTN
DAADAHRVLKPLADVIQAKWKGKAKLWMETTPYPSYLAYVTGVYAPRPGGYGWWEVSRLLDKKTLSGDTKALGRA
LQAVKSNRGNLFAMTLAGKGVQEVKPPGGGNSVNPAWRVAYALAMTSLTFRSTDPNVSKDTRDFLNKAWQPLRDL
TPQTGSNIDEGMPYEKDWQHTFWGSNYERLAKIKRRVDPDDVLWCSPCVGNERWRQGQDGRLCRIH
Coding >Ophio5|1641
ATGGCGACCCGGACTCTGCTACTGGCTCTCTGCTGCCTGTTCAGTCTGCTAGGCTTCGCCTCCGGCACTACTAGG
CACTGCAAAGCCTTCCCGGGAGGTCGGGACTGGCCGTCCAAGGAGTCCTGGCATGGCTTCAATAGGACGCTCGGC
GGACGACTCCTCGCTCCCAGGCCGCCTGGCACCGTCTGCCACCGCGACCAGCCGACGTACAGCCCGACTCAGTGC
CCCAATGTGCAGAGGCTGTGGACGACGTTTGAATTCCACGCGCAGAACCCGGTATCGGTGGTGTGGAATCAGTGG
ACCGGCTTCGACTGTCTGCCTGATGCGACGACGCCTTGCAGTGGCAAAGGATATCCGCCTTATGTCGTGGATGCG
TCCAACGCCAAGCACGTCAAGCTGGCTGTCGACTTTGCTCGTACGCGCAACGTCAGACTCGTCGTCAAGAACACG
GGCTACGATTTCCTCGGCCGTTCTACCGCCCCCGGCGCGCTCTCCATCTGGACCCTCCACATGAACTCCATCCAG
TATCATCCCAAGGGCCAATTCAAGCTCAGCGGGTCCAGACGGCCTTTCAGGGGGAATGCCGTCACTGTCGGCGCC
GGAGCGCTCACCAACGACATCTACCGCGCCTTGGACAAATATGGCCAGCTTTTCATTGGTGCCATGGGCCCGACT
GTCGGTATTGCCGGCTACCTGTCGAGCGGTGGTCACTCCAACCTGTCTGGCCGGTACGGACTGGGGGCCGACACC
GTTCTCGAAATGGAGGTGGTGACTCCCGAGGGCGAGATATTGACCGTCAACGAGCACTGTCACCGTGATTTGTTC
TGGGCCCTGCGAGGTGGCGGCGGCTCGACCTTTGGCGTCGTTACCAAAATCACGATGCAGACCTATCCGTCCCCC
AAAGTCCTCGGCATCCACTGGGTAGTCGGAATCGAAGCCCAAGATGCCAGAGCCTCCGAGCTGGCCCCCGATCTC
CTGTCCAAGCTCCCCGATGCCATCGACGCCGGACTCCTGGGCTGGACCGCCATCGCCGACAACGTGCTCAACCCC
GTCCCCGTTGCCGGCTCTCCCGTGGCTGGAAACGTGAGCGGCTTGTACGGAGTCAACGCCGTTCTCGACACCAAC
GACGCCGCCGACGCTCACCGGGTCTTGAAACCCCTGGCAGACGTCATCCAGGCCAAGTGGAAGGGAAAGGCTAAG
CTCTGGATGGAGACGACACCGTACCCGTCTTACCTGGCCTACGTCACCGGCGTCTACGCCCCCAGACCAGGCGGC
TACGGCTGGTGGGAGGTGTCTCGGCTGCTGGACAAGAAGACGCTCAGCGGAGATACGAAGGCGCTCGGCCGGGCC
CTACAGGCCGTCAAGAGCAACAGGGGAAACCTCTTTGCCATGACCCTCGCTGGAAAGGGCGTTCAGGAGGTGAAG
CCTCCCGGCGGAGGCAACTCGGTCAACCCTGCGTGGCGCGTCGCCTACGCCCTCGCCATGACCTCTCTGACGTTT
AGATCTACCGATCCAAACGTCAGCAAGGACACGCGTGATTTCCTTAATAAGGCCTGGCAACCGTTGCGGGACCTG
ACTCCCCAGACCGGCTCTAACATTGACGAGGGCATGCCCTACGAAAAGGACTGGCAGCACACCTTCTGGGGCTCC
AACTACGAGCGGCTGGCCAAGATCAAGCGCCGGGTCGATCCGGACGACGTGCTGTGGTGCTCGCCCTGTGTGGGC
AACGAGCGCTGGCGACAGGGCCAAGATGGGCGCTTGTGCAGGATTCAC
Transcript >Ophio5|1641
ATGGCGACCCGGACTCTGCTACTGGCTCTCTGCTGCCTGTTCAGTCTGCTAGGCTTCGCCTCCGGCACTACTAGG
CACTGCAAAGCCTTCCCGGGAGGTCGGGACTGGCCGTCCAAGGAGTCCTGGCATGGCTTCAATAGGACGCTCGGC
GGACGACTCCTCGCTCCCAGGCCGCCTGGCACCGTCTGCCACCGCGACCAGCCGACGTACAGCCCGACTCAGTGC
CCCAATGTGCAGAGGCTGTGGACGACGTTTGAATTCCACGCGCAGAACCCGGTATCGGTGGTGTGGAATCAGTGG
ACCGGCTTCGACTGTCTGCCTGATGCGACGACGCCTTGCAGTGGCAAAGGATATCCGCCTTATGTCGTGGATGCG
TCCAACGCCAAGCACGTCAAGCTGGCTGTCGACTTTGCTCGTACGCGCAACGTCAGACTCGTCGTCAAGAACACG
GGCTACGATTTCCTCGGCCGTTCTACCGCCCCCGGCGCGCTCTCCATCTGGACCCTCCACATGAACTCCATCCAG
TATCATCCCAAGGGCCAATTCAAGCTCAGCGGGTCCAGACGGCCTTTCAGGGGGAATGCCGTCACTGTCGGCGCC
GGAGCGCTCACCAACGACATCTACCGCGCCTTGGACAAATATGGCCAGCTTTTCATTGGTGCCATGGGCCCGACT
GTCGGTATTGCCGGCTACCTGTCGAGCGGTGGTCACTCCAACCTGTCTGGCCGGTACGGACTGGGGGCCGACACC
GTTCTCGAAATGGAGGTGGTGACTCCCGAGGGCGAGATATTGACCGTCAACGAGCACTGTCACCGTGATTTGTTC
TGGGCCCTGCGAGGTGGCGGCGGCTCGACCTTTGGCGTCGTTACCAAAATCACGATGCAGACCTATCCGTCCCCC
AAAGTCCTCGGCATCCACTGGGTAGTCGGAATCGAAGCCCAAGATGCCAGAGCCTCCGAGCTGGCCCCCGATCTC
CTGTCCAAGCTCCCCGATGCCATCGACGCCGGACTCCTGGGCTGGACCGCCATCGCCGACAACGTGCTCAACCCC
GTCCCCGTTGCCGGCTCTCCCGTGGCTGGAAACGTGAGCGGCTTGTACGGAGTCAACGCCGTTCTCGACACCAAC
GACGCCGCCGACGCTCACCGGGTCTTGAAACCCCTGGCAGACGTCATCCAGGCCAAGTGGAAGGGAAAGGCTAAG
CTCTGGATGGAGACGACACCGTACCCGTCTTACCTGGCCTACGTCACCGGCGTCTACGCCCCCAGACCAGGCGGC
TACGGCTGGTGGGAGGTGTCTCGGCTGCTGGACAAGAAGACGCTCAGCGGAGATACGAAGGCGCTCGGCCGGGCC
CTACAGGCCGTCAAGAGCAACAGGGGAAACCTCTTTGCCATGACCCTCGCTGGAAAGGGCGTTCAGGAGGTGAAG
CCTCCCGGCGGAGGCAACTCGGTCAACCCTGCGTGGCGCGTCGCCTACGCCCTCGCCATGACCTCTCTGACGTTT
AGATCTACCGATCCAAACGTCAGCAAGGACACGCGTGATTTCCTTAATAAGGCCTGGCAACCGTTGCGGGACCTG
ACTCCCCAGACCGGCTCTAACATTGACGAGGGCATGCCCTACGAAAAGGACTGGCAGCACACCTTCTGGGGCTCC
AACTACGAGCGGCTGGCCAAGATCAAGCGCCGGGTCGATCCGGACGACGTGCTGTGGTGCTCGCCCTGTGTGGGC
AACGAGCGCTGGCGACAGGGCCAAGATGGGCGCTTGTGCAGGATTCACTGA
Gene >Ophio5|1641
ATGGCGACCCGGACTCTGCTACTGGCTCTCTGCTGCCTGTTCAGTCTGCTAGGCTTCGCCTCCGGCACTACTAGG
CACTGCAAAGCCTTCCCGGGAGGTCGGGACTGGCCGTCCAAGGAGTCCTGGCATGGCTTCAATAGGACGCTCGGC
GGACGACTCCTCGCTCCCAGGCCGCCTGGCACCGTCTGCCACCGCGACCAGCCGACGTACAGCCCGACTCAGTGC
CCCAATGTGCAGAGGCTGTGGACGACGTTTGAATTCCACGCGCAGAACCCGGTATCGGTGGTGTGGAATCAGTGG
ACCGGCTTCGACTGTCTGCCTGATGCGACGACGCCTTGCAGTGGCAAAGGATATCCGCCTTATGTCGTGGATGCG
TCCAACGCCAAGCACGTCAAGCTGGCTGTCGACTTTGGTGCGTTCATCTCAATGAGTCTTGTTGGACGTTACTGT
CTACAGGTATTGACTCTAGACTTCATATATACAGCTCGTACGCGCAACGTCAGACTCGTCGTCAAGAACACGGGC
TACGATTTCCTCGGCCGTTCTACCGCCCCCGGCGCGCTCTCCATCTGGACCCTCCACATGAACTCCATCCAGTAT
CATCCCAAGGGCCAATTCAAGCTCAGCGGGTCCAGACGGCCTTTCAGGGGGAATGCCGTCACTGTCGGCGCCGGA
GCGCTCACCAACGACATCTACCGCGCCTTGGACAAATATGGCCAGCTTTTCATTGGTGCCATGGGCCCGACTGTC
GGTATTGCCGGCTACCTGTCGAGCGGTGGTCACTCCAACCTGTCTGGCCGGTACGGACTGGGGGCCGACACCGTT
CTCGAAATGGAGGTGGTGACTCCCGAGGGCGAGATATTGACCGTCAACGAGCACTGTCACCGTGATTTGTTCTGG
GCCCTGCGAGGTGTAAGTCTCCCGTCTTGGTCGAACAAGAAAAACAAAAGAAGGACACTGAACCCCATCTCCAGG
GCGGCGGCTCGACCTTTGGCGTCGTTACCAAAATCACGATGCAGACCTATCCGTCCCCCAAAGTCCTCGGCATCC
ACTGGGTAGTCGGAATCGAAGCCCAAGATGCCAGAGCCTCCGAGCTGGCCCCCGATCTCCTGTCCAAGCTCCCCG
ATGCCATCGACGCCGGACTCCTGGGCTGGACCGCCATCGCCGACAACGTGCTCAACCCCGTCCCCGTTGCCGGCT
CTCCCGTGGCTGGAAACGTGAGCGGCTTGTACGGAGTCAACGCCGTTCTCGACACCAACGACGCCGCCGACGCTC
ACCGGGTCTTGAAACCCCTGGCAGACGTCATCCAGGCCAAGTGGAAGGGAAAGGCTAAGCTCTGGATGGAGACGA
CACCGTACCCGTCTTACCTGGCCTACGTCACCGGCGTCTACGCCCCCAGACCAGGCGGCTACGGCTGGTGGGAGG
TGTCTCGGCTGCTGGACAAGAAGACGCTCAGCGGAGATACGAAGGCGCTCGGCCGGGCCCTACAGGCCGTCAAGA
GCAACAGGGGAAACCTCTTTGCCATGACCCTCGCTGGAAAGGGCGTTCAGGAGGTGAAGCCTCCCGGCGGAGGCA
ACTCGGTCAACCCTGCGTGGCGCGTCGCCTACGCCCTCGCCAGTATGTTTTTTTTTTCTTGGGTCTTATGAGAGA
CTCTGCAAACACGGCTGACGCCCCTGAACAGTGACCTCTCTGACGTTTAGATCTACCGATCCAAACGTCAGCAAG
GACACGCGTGATTTCCTTAATAAGGCCTGGCAACCGTTGCGGGACCTGACTCCCCAGACCGGCTCTAACATTGAC
GAGGTATGTTCGATCTGTTCTTTGTTTTCCAGTCAGCTTTTTTTTTTTTGCGTCTCAACTCTTTCTGATGCTCGT
CGCTACAGGGCATGCCCTACGAAAAGGACTGGCAGCACACCTTCTGGGGCTCCAACTACGAGCGGCTGGCCAAGA
TCAAGCGCCGGGTCGATCCGGACGACGTGCTGTGGTGCTCGCCCTGTGTGGGCAACGAGCGCTGGCGACAGGGCC
AAGATGGGCGCTTGTGCAGGATTCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail