Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1629
Gene name
Locationscaffold_16:37395..38637
Strand-
Gene length (bp)1242
Transcript length (bp)1242
Coding sequence length (bp)1239
Protein length (aa) 413

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06027 SLC35F Solute carrier family 35 2.9E-93 62 357

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59785|YCN8_SCHPO Uncharacterized solute carrier family 35 member C320.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC320.08 PE=1 SV=1 13 386 7.0E-87
sp|Q8IXU6|S35F2_HUMAN Solute carrier family 35 member F2 OS=Homo sapiens GN=SLC35F2 PE=1 SV=1 32 356 2.0E-62
sp|Q5T1Q4|S35F1_HUMAN Solute carrier family 35 member F1 OS=Homo sapiens GN=SLC35F1 PE=2 SV=2 59 365 5.0E-60
sp|Q7TML3|S35F2_MOUSE Solute carrier family 35 member F2 OS=Mus musculus GN=Slc35f2 PE=1 SV=2 70 356 1.0E-59
sp|Q8BGK5|S35F1_MOUSE Solute carrier family 35 member F1 OS=Mus musculus GN=Slc35f1 PE=1 SV=1 40 365 2.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59785|YCN8_SCHPO Uncharacterized solute carrier family 35 member C320.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC320.08 PE=1 SV=1 13 386 7.0E-87
sp|Q8IXU6|S35F2_HUMAN Solute carrier family 35 member F2 OS=Homo sapiens GN=SLC35F2 PE=1 SV=1 32 356 2.0E-62
sp|Q5T1Q4|S35F1_HUMAN Solute carrier family 35 member F1 OS=Homo sapiens GN=SLC35F1 PE=2 SV=2 59 365 5.0E-60
sp|Q7TML3|S35F2_MOUSE Solute carrier family 35 member F2 OS=Mus musculus GN=Slc35f2 PE=1 SV=2 70 356 1.0E-59
sp|Q8BGK5|S35F1_MOUSE Solute carrier family 35 member F1 OS=Mus musculus GN=Slc35f1 PE=1 SV=1 40 365 2.0E-59
sp|Q0V9U2|S35F2_XENTR Solute carrier family 35 member F2 OS=Xenopus tropicalis GN=slc35f2 PE=2 SV=2 59 365 6.0E-54
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

Domain # Start End Length
1 64 86 22
2 96 118 22
3 131 153 22
4 163 182 19
5 189 208 19
6 223 245 22
7 252 270 18
8 285 307 22
9 314 336 22
10 341 363 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1629
MPVHLPTTPTTPVDETICPPPSPPLLHQHDQSPDAEAEAAAAGLALLESRHRHCWYGYVTSREFLVVALLGQLLS
LCITATNTFTTLLARAEFNAPALQTCFNYALIGTVFTAVVVIRDGPRAWFRALRLRGWRYLALAALDVEANYFTV
LAYQHTTILSAQLINFWSIVCVVAASALLLRVRYRPQQLVGILVCCAGMGLLIATDHLGQRNGGPANDPLRGDLF
ALLGATLYGLSNVMEEWLVSKDAAHDVLAFLGLFGLVINGVQAAIFDRAALAAAAWSGPVAGWLVGYTLCLSLFY
SLAPLVLRMASAAFFDVSLLTANFWGVIIGVRLFAYSVHFLYPLAFLCIVAGLVLYFIAGTFLGDARKPWLARDQ
HDGIAGVGTAKLRAINAARHRHGPPVGLWDRFRRLLGA
Coding >Ophio5|1629
ATGCCCGTTCATCTACCCACGACGCCCACAACACCCGTCGACGAAACTATCTGTCCTCCTCCCTCTCCTCCCCTT
TTACACCAACACGACCAATCTCCAGACGCAGAGGCCGAAGCAGCAGCGGCCGGTCTCGCCCTCCTCGAAAGCCGG
CACCGCCATTGCTGGTACGGCTACGTAACGTCGCGAGAATTCCTCGTCGTCGCTCTCCTCGGCCAGCTGCTTTCG
CTCTGCATCACTGCTACCAACACCTTCACCACTCTTCTGGCCCGGGCCGAGTTTAACGCGCCGGCGCTGCAGACG
TGCTTCAATTACGCCCTCATCGGCACCGTCTTTACCGCCGTCGTCGTCATTCGTGACGGGCCCCGCGCTTGGTTT
CGGGCCCTGCGTCTTCGCGGATGGCGCTATCTCGCTCTCGCTGCTCTCGATGTCGAGGCCAATTATTTCACCGTT
CTTGCCTATCAGCATACTACCATCCTTTCCGCCCAGCTCATCAACTTTTGGTCCATCGTTTGTGTCGTGGCCGCT
TCCGCTCTTCTCTTGCGCGTGCGTTACCGTCCCCAGCAACTCGTCGGTATCCTCGTCTGTTGCGCCGGCATGGGC
CTCCTCATCGCCACCGACCATCTCGGTCAGCGAAATGGCGGCCCTGCGAATGACCCCCTCCGCGGCGACCTCTTC
GCTCTCCTCGGCGCGACCCTCTACGGTCTCAGCAACGTGATGGAGGAATGGCTCGTCAGCAAGGATGCCGCTCAT
GACGTGCTCGCCTTCCTCGGCCTCTTCGGCCTCGTCATCAACGGCGTACAGGCCGCCATCTTCGACCGAGCGGCC
CTCGCCGCCGCCGCCTGGTCCGGCCCCGTCGCCGGCTGGCTCGTCGGCTACACGCTCTGTCTATCGCTCTTCTAC
TCGCTCGCCCCGCTCGTGCTGCGCATGGCCAGCGCCGCCTTCTTCGACGTGTCGCTGCTGACGGCCAACTTCTGG
GGCGTCATCATCGGCGTCCGTCTCTTCGCCTACTCGGTCCACTTCCTCTATCCACTCGCCTTTCTCTGCATCGTC
GCCGGCCTCGTCCTCTACTTCATCGCCGGCACCTTTCTCGGCGACGCCCGCAAACCATGGCTCGCGCGCGATCAG
CACGACGGCATCGCCGGCGTCGGAACCGCAAAGTTGCGCGCCATCAACGCCGCTCGTCATCGTCATGGTCCGCCC
GTGGGGTTATGGGATCGCTTCCGTCGCTTGCTTGGGGCT
Transcript >Ophio5|1629
ATGCCCGTTCATCTACCCACGACGCCCACAACACCCGTCGACGAAACTATCTGTCCTCCTCCCTCTCCTCCCCTT
TTACACCAACACGACCAATCTCCAGACGCAGAGGCCGAAGCAGCAGCGGCCGGTCTCGCCCTCCTCGAAAGCCGG
CACCGCCATTGCTGGTACGGCTACGTAACGTCGCGAGAATTCCTCGTCGTCGCTCTCCTCGGCCAGCTGCTTTCG
CTCTGCATCACTGCTACCAACACCTTCACCACTCTTCTGGCCCGGGCCGAGTTTAACGCGCCGGCGCTGCAGACG
TGCTTCAATTACGCCCTCATCGGCACCGTCTTTACCGCCGTCGTCGTCATTCGTGACGGGCCCCGCGCTTGGTTT
CGGGCCCTGCGTCTTCGCGGATGGCGCTATCTCGCTCTCGCTGCTCTCGATGTCGAGGCCAATTATTTCACCGTT
CTTGCCTATCAGCATACTACCATCCTTTCCGCCCAGCTCATCAACTTTTGGTCCATCGTTTGTGTCGTGGCCGCT
TCCGCTCTTCTCTTGCGCGTGCGTTACCGTCCCCAGCAACTCGTCGGTATCCTCGTCTGTTGCGCCGGCATGGGC
CTCCTCATCGCCACCGACCATCTCGGTCAGCGAAATGGCGGCCCTGCGAATGACCCCCTCCGCGGCGACCTCTTC
GCTCTCCTCGGCGCGACCCTCTACGGTCTCAGCAACGTGATGGAGGAATGGCTCGTCAGCAAGGATGCCGCTCAT
GACGTGCTCGCCTTCCTCGGCCTCTTCGGCCTCGTCATCAACGGCGTACAGGCCGCCATCTTCGACCGAGCGGCC
CTCGCCGCCGCCGCCTGGTCCGGCCCCGTCGCCGGCTGGCTCGTCGGCTACACGCTCTGTCTATCGCTCTTCTAC
TCGCTCGCCCCGCTCGTGCTGCGCATGGCCAGCGCCGCCTTCTTCGACGTGTCGCTGCTGACGGCCAACTTCTGG
GGCGTCATCATCGGCGTCCGTCTCTTCGCCTACTCGGTCCACTTCCTCTATCCACTCGCCTTTCTCTGCATCGTC
GCCGGCCTCGTCCTCTACTTCATCGCCGGCACCTTTCTCGGCGACGCCCGCAAACCATGGCTCGCGCGCGATCAG
CACGACGGCATCGCCGGCGTCGGAACCGCAAAGTTGCGCGCCATCAACGCCGCTCGTCATCGTCATGGTCCGCCC
GTGGGGTTATGGGATCGCTTCCGTCGCTTGCTTGGGGCTTGA
Gene >Ophio5|1629
ATGCCCGTTCATCTACCCACGACGCCCACAACACCCGTCGACGAAACTATCTGTCCTCCTCCCTCTCCTCCCCTT
TTACACCAACACGACCAATCTCCAGACGCAGAGGCCGAAGCAGCAGCGGCCGGTCTCGCCCTCCTCGAAAGCCGG
CACCGCCATTGCTGGTACGGCTACGTAACGTCGCGAGAATTCCTCGTCGTCGCTCTCCTCGGCCAGCTGCTTTCG
CTCTGCATCACTGCTACCAACACCTTCACCACTCTTCTGGCCCGGGCCGAGTTTAACGCGCCGGCGCTGCAGACG
TGCTTCAATTACGCCCTCATCGGCACCGTCTTTACCGCCGTCGTCGTCATTCGTGACGGGCCCCGCGCTTGGTTT
CGGGCCCTGCGTCTTCGCGGATGGCGCTATCTCGCTCTCGCTGCTCTCGATGTCGAGGCCAATTATTTCACCGTT
CTTGCCTATCAGCATACTACCATCCTTTCCGCCCAGCTCATCAACTTTTGGTCCATCGTTTGTGTCGTGGCCGCT
TCCGCTCTTCTCTTGCGCGTGCGTTACCGTCCCCAGCAACTCGTCGGTATCCTCGTCTGTTGCGCCGGCATGGGC
CTCCTCATCGCCACCGACCATCTCGGTCAGCGAAATGGCGGCCCTGCGAATGACCCCCTCCGCGGCGACCTCTTC
GCTCTCCTCGGCGCGACCCTCTACGGTCTCAGCAACGTGATGGAGGAATGGCTCGTCAGCAAGGATGCCGCTCAT
GACGTGCTCGCCTTCCTCGGCCTCTTCGGCCTCGTCATCAACGGCGTACAGGCCGCCATCTTCGACCGAGCGGCC
CTCGCCGCCGCCGCCTGGTCCGGCCCCGTCGCCGGCTGGCTCGTCGGCTACACGCTCTGTCTATCGCTCTTCTAC
TCGCTCGCCCCGCTCGTGCTGCGCATGGCCAGCGCCGCCTTCTTCGACGTGTCGCTGCTGACGGCCAACTTCTGG
GGCGTCATCATCGGCGTCCGTCTCTTCGCCTACTCGGTCCACTTCCTCTATCCACTCGCCTTTCTCTGCATCGTC
GCCGGCCTCGTCCTCTACTTCATCGCCGGCACCTTTCTCGGCGACGCCCGCAAACCATGGCTCGCGCGCGATCAG
CACGACGGCATCGCCGGCGTCGGAACCGCAAAGTTGCGCGCCATCAACGCCGCTCGTCATCGTCATGGTCCGCCC
GTGGGGTTATGGGATCGCTTCCGTCGCTTGCTTGGGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail