Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1625
Gene name
Locationscaffold_16:21597..23118
Strand+
Gene length (bp)1521
Transcript length (bp)1047
Coding sequence length (bp)1044
Protein length (aa) 348

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7559 0.1819 0.0502 0.1012 0.1455 0.0046 0.0723 0.0971 0.2101 0.0423

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1915
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|660
Ophiocordyceps australis map64 (Brazil) OphauB2|4579
Ophiocordyceps camponoti-floridani Ophcf2|03882
Ophiocordyceps camponoti-rufipedis Ophun1|144
Ophiocordyceps kimflemingae Ophio5|1625 (this protein)
Ophiocordyceps subramaniannii Hirsu2|201

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1625
MSYYDNPQWSGPAQNNWDHQGAAAAAPVRTAGASGPQPQDDFAFSYQFDEVDRAYENLQKSGKGYAMGGRRSDLR
ISHGAGPRSHPVNAFDDVRGPQPPSLHNFYASQRHQPSRGTNEAEQFMQSKRRMAAQRERELRNRHTEQQYQRND
LAEPTQHGNKHMSEEETRELIARQRSALYGEGPFADKSSYVDESGNIRPGAPRPSGPPSLRGPSPLTFDGIGRAS
SGPDAATPASMADQTAGPSPRPQSNTSPQTTGKAFDGAIGTQSRTSSSSPTRGSPPRDLAPGSKPGQHSTAVAPI
GTRPSATSSAAAPAKRSTTPLTSPGSWGRGNGVWGQSSGLGAQASVWG
Coding >Ophio5|1625
ATGTCCTACTACGACAATCCCCAGTGGTCTGGCCCTGCCCAGAACAATTGGGACCATCAGGGCGCCGCCGCCGCT
GCTCCTGTTCGTACTGCAGGTGCAAGCGGCCCTCAGCCTCAGGACGACTTTGCCTTCTCCTACCAGTTTGACGAG
GTCGATCGCGCCTATGAGAACCTTCAAAAGTCCGGCAAGGGCTATGCCATGGGCGGACGCCGCTCAGATCTACGG
ATCTCTCACGGTGCTGGCCCCCGCTCTCACCCCGTCAACGCCTTCGACGACGTCCGCGGCCCCCAGCCGCCCAGC
CTCCACAACTTTTACGCTTCTCAGCGCCATCAGCCTTCGCGAGGCACCAATGAAGCAGAGCAGTTTATGCAGTCC
AAGAGAAGGATGGCAGCCCAGCGGGAACGGGAATTGCGCAACCGACACACGGAGCAGCAATACCAACGAAATGAC
TTGGCCGAGCCCACCCAACATGGAAACAAGCACATGTCGGAGGAGGAGACGCGCGAGCTCATCGCCCGCCAGCGA
AGCGCCCTATACGGAGAAGGCCCCTTTGCCGACAAGAGTAGCTACGTTGACGAATCGGGCAATATCCGACCGGGC
GCACCGCGCCCCAGTGGCCCCCCAAGCCTGCGCGGACCCTCGCCTCTTACTTTTGACGGCATCGGACGCGCCTCG
TCCGGTCCGGACGCCGCCACCCCGGCCTCGATGGCCGATCAGACCGCCGGCCCCAGCCCGCGCCCGCAGAGCAAT
ACCAGCCCGCAGACGACCGGCAAGGCTTTTGACGGCGCCATTGGTACCCAGAGTCGCACGAGCTCCTCGAGCCCC
ACCCGTGGGTCCCCTCCTCGCGACCTGGCCCCGGGATCCAAGCCTGGCCAGCACTCGACCGCCGTCGCTCCCATC
GGCACGCGTCCGTCCGCCACATCTTCGGCTGCTGCTCCCGCAAAGCGCTCCACCACGCCCCTTACCTCGCCTGGT
AGCTGGGGACGCGGCAACGGCGTCTGGGGCCAATCTTCCGGTCTCGGCGCCCAGGCCAGCGTCTGGGGC
Transcript >Ophio5|1625
ATGTCCTACTACGACAATCCCCAGTGGTCTGGCCCTGCCCAGAACAATTGGGACCATCAGGGCGCCGCCGCCGCT
GCTCCTGTTCGTACTGCAGGTGCAAGCGGCCCTCAGCCTCAGGACGACTTTGCCTTCTCCTACCAGTTTGACGAG
GTCGATCGCGCCTATGAGAACCTTCAAAAGTCCGGCAAGGGCTATGCCATGGGCGGACGCCGCTCAGATCTACGG
ATCTCTCACGGTGCTGGCCCCCGCTCTCACCCCGTCAACGCCTTCGACGACGTCCGCGGCCCCCAGCCGCCCAGC
CTCCACAACTTTTACGCTTCTCAGCGCCATCAGCCTTCGCGAGGCACCAATGAAGCAGAGCAGTTTATGCAGTCC
AAGAGAAGGATGGCAGCCCAGCGGGAACGGGAATTGCGCAACCGACACACGGAGCAGCAATACCAACGAAATGAC
TTGGCCGAGCCCACCCAACATGGAAACAAGCACATGTCGGAGGAGGAGACGCGCGAGCTCATCGCCCGCCAGCGA
AGCGCCCTATACGGAGAAGGCCCCTTTGCCGACAAGAGTAGCTACGTTGACGAATCGGGCAATATCCGACCGGGC
GCACCGCGCCCCAGTGGCCCCCCAAGCCTGCGCGGACCCTCGCCTCTTACTTTTGACGGCATCGGACGCGCCTCG
TCCGGTCCGGACGCCGCCACCCCGGCCTCGATGGCCGATCAGACCGCCGGCCCCAGCCCGCGCCCGCAGAGCAAT
ACCAGCCCGCAGACGACCGGCAAGGCTTTTGACGGCGCCATTGGTACCCAGAGTCGCACGAGCTCCTCGAGCCCC
ACCCGTGGGTCCCCTCCTCGCGACCTGGCCCCGGGATCCAAGCCTGGCCAGCACTCGACCGCCGTCGCTCCCATC
GGCACGCGTCCGTCCGCCACATCTTCGGCTGCTGCTCCCGCAAAGCGCTCCACCACGCCCCTTACCTCGCCTGGT
AGCTGGGGACGCGGCAACGGCGTCTGGGGCCAATCTTCCGGTCTCGGCGCCCAGGCCAGCGTCTGGGGCTGA
Gene >Ophio5|1625
ATGTCCTACTACGACAATCCCCAGTGGTCTGGCCCTGCCCAGAACAATTGGGACCATCAGGGCGCCGCCGCCGCT
GCTCCTGTTCGTACTGGTACGTGTCGCCTCTGTCCGCGCCTCCGCTTCTTCCCACTTATCCCCCAAGAAGCAGGT
GCAAGCGGCCCTCAGCCTCAGGACGACTTTGCCTTCTCCTACCAGTTTGACGGTACGTCATTGTTCCGCGCCGAT
TCTCCCCCTCCGCACCTCGTCCGGCCCTCGCCGACCATCCTCCGCCTTTACTGATCCGTGCCCACCTTTGCGCCC
TCGGCAGAGGTCGATCGCGCCTATGAGAACCTTCAAAAGTCCGGCAAGGGCTATGCCATGGGCGGACGCCGTGAG
TAGTCACCGAACACCCTTTCGACCTGTTAGGCCGGCTGATATCTCCGGCTCACCTCGGCCGCCGCCCGTCGGGAG
CGGGTCGATCAACGAGGACCTTCCGCTAACCTGCCGACGCCCTGTCCCCATAGGCTCAGATCTACGGATCTCTCA
CGGTGCTGGCCCCCGCTCTCACCCCGTCAACGCCTTCGACGACGTCCGCGGCCCCCAGCCGCCCAGCCTCCACAA
CTTTTACGCTTCTCAGCGCCATCAGCCTTCGCGAGGCACCAATGAAGCAGAGCAGTTTATGCAGTCCAAGAGAAG
GATGGCAGCCCAGCGGGAACGGGAATTGCGCAACCGACACACGGAGCAGCAATACCAACGAAGTAGGCCGCCCTC
TACTGTTTAGCATTCGCGTGTCGGAATCGAGGATACCCCCCCCCCCCCAAAAAAAAAAGAAATAGACAGATGCGG
AGCGCCGCTATCCCTTGGCCGACGTGGCCATGGTGAAGAGACGACGGCTTCTGCGGATTCGTCGAGCATGCGCTA
ACCGTCGTCTCCAACGTAGATGACTTGGCCGAGCCCACCCAACATGGAAACAAGCACATGTCGGAGGAGGAGACG
CGCGAGCTCATCGCCCGCCAGCGAAGCGCCCTATACGGAGAAGGCCCCTTTGCCGACAAGAGTAGCTACGTTGAC
GAATCGGGCAATATCCGACCGGGCGCACCGCGCCCCAGTGGCCCCCCAAGCCTGCGCGGACCCTCGCCTCTTACT
TTTGACGGCATCGGACGCGCCTCGTCCGGTCCGGACGCCGCCACCCCGGCCTCGATGGCCGATCAGACCGCCGGC
CCCAGCCCGCGCCCGCAGAGCAATACCAGCCCGCAGACGACCGGCAAGGCTTTTGACGGCGCCATTGGTACCCAG
AGTCGCACGAGCTCCTCGAGCCCCACCCGTGGGTCCCCTCCTCGCGACCTGGCCCCGGGATCCAAGCCTGGCCAG
CACTCGACCGCCGTCGCTCCCATCGGCACGCGTCCGTCCGCCACATCTTCGGCTGCTGCTCCCGCAAAGCGCTCC
ACCACGCCCCTTACCTCGCCTGGTAGCTGGGGACGCGGCAACGGCGTCTGGGGCCAATCTTCCGGTCTCGGCGCC
CAGGCCAGCGTCTGGGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail