Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1624
Gene name
Locationscaffold_16:18188..19876
Strand-
Gene length (bp)1688
Transcript length (bp)1623
Coding sequence length (bp)1620
Protein length (aa) 540

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03403 PAF-AH_p_II Platelet-activating factor acetylhydrolase, isoform II 1.3E-29 95 348

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P79106|PAFA2_BOVIN Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Bos taurus GN=PAFAH2 PE=1 SV=1 95 342 8.0E-19
sp|Q22943|PAFA_CAEEL Platelet-activating factor acetylhydrolase homolog 2 OS=Caenorhabditis elegans GN=paf-2 PE=2 SV=2 99 491 7.0E-18
sp|Q28262|PAFA_CANLF Platelet-activating factor acetylhydrolase OS=Canis lupus familiaris GN=PLA2G7 PE=2 SV=1 95 507 1.0E-17
sp|Q99487|PAFA2_HUMAN Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Homo sapiens GN=PAFAH2 PE=1 SV=1 95 358 8.0E-17
sp|Q28017|PAFA_BOVIN Platelet-activating factor acetylhydrolase OS=Bos taurus GN=PLA2G7 PE=2 SV=1 94 392 1.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P79106|PAFA2_BOVIN Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Bos taurus GN=PAFAH2 PE=1 SV=1 95 342 8.0E-19
sp|Q22943|PAFA_CAEEL Platelet-activating factor acetylhydrolase homolog 2 OS=Caenorhabditis elegans GN=paf-2 PE=2 SV=2 99 491 7.0E-18
sp|Q28262|PAFA_CANLF Platelet-activating factor acetylhydrolase OS=Canis lupus familiaris GN=PLA2G7 PE=2 SV=1 95 507 1.0E-17
sp|Q99487|PAFA2_HUMAN Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Homo sapiens GN=PAFAH2 PE=1 SV=1 95 358 8.0E-17
sp|Q28017|PAFA_BOVIN Platelet-activating factor acetylhydrolase OS=Bos taurus GN=PLA2G7 PE=2 SV=1 94 392 1.0E-16
sp|Q8VDG7|PAFA2_MOUSE Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Mus musculus GN=Pafah2 PE=1 SV=2 95 358 2.0E-16
sp|Q13093|PAFA_HUMAN Platelet-activating factor acetylhydrolase OS=Homo sapiens GN=PLA2G7 PE=1 SV=1 149 493 8.0E-16
sp|P83006|PAFA2_RAT Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Rattus norvegicus GN=Pafah2 PE=1 SV=2 95 358 1.0E-15
sp|Q60963|PAFA_MOUSE Platelet-activating factor acetylhydrolase OS=Mus musculus GN=Pla2g7 PE=2 SV=2 73 485 1.0E-14
sp|Q90678|PAFA_CHICK Platelet-activating factor acetylhydrolase OS=Gallus gallus GN=PLA2G7 PE=2 SV=1 95 358 5.0E-14
sp|Q9URV1|PLG7_SCHPO Putative phospholipase A2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plg7 PE=3 SV=1 92 338 8.0E-12
sp|P70683|PAFA_CAVPO Platelet-activating factor acetylhydrolase OS=Cavia porcellus GN=PLA2G7 PE=2 SV=1 187 359 2.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016042 lipid catabolic process Yes
GO:0003847 1-alkyl-2-acetylglycerophosphocholine esterase activity Yes
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0009056 catabolic process No
GO:0006629 lipid metabolic process No
GO:0052689 carboxylic ester hydrolase activity No
GO:0003824 catalytic activity No
GO:1901575 organic substance catabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 68 90 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1624
MVAAALSKPLAAVSPSLRPTSLGLELDYLADPPSDSDLAPDSPLAIRPRWMPPPPSSSSVRLLSRRRLVTALIAL
IALYLLTCLLRSVPPFARPLPSYSGRHAVGSVDIEVPLPDAPRRIAGVFDLDSVLFTLYHPVAHDSSSARRRPWI
DRPVGPTARGFARLLGLDFFLVRWLFTFVLWTLAGPVRIPAAVDAPLLPSDDRLPVIVFSHGMASSRTDYTAYIG
ELASRGFVVAAVEHRDGSCPGSVVAPDRPVLSLRGPDDLLQSNISRTAFKRAQITVRTAEMLETIRVLRDLDAGH
GPDMFAANARREGAHLATFGNRLALTDGLALAGHSMGATAVLHAVHALSAPVPVIALDPGKQSGRLSPDDAGDGL
ASPLLVLHSAAWSRPSTSLFYGRPHFDAVCSMVRAALGRSSSAWFLTGLDTAHPSISDAPLLEPLLLRFATGFRL
RDPLASLRRHANLSAEFLHLSAGHANHSADLLPGSLLAESVTHSTFGHWLSPGRRRSFPKDWATQWEIHVSPAAA
EPRQMHVISPPVPGL
Coding >Ophio5|1624
ATGGTGGCTGCCGCGCTAAGCAAGCCCCTTGCCGCCGTCTCACCGAGCCTTCGTCCGACCTCCCTCGGCCTCGAG
CTCGATTACCTCGCCGACCCTCCTAGCGACTCCGACCTCGCCCCCGACTCTCCCCTAGCCATCCGCCCCAGATGG
ATGCCTCCGCCTCCCTCGTCGTCGTCGGTCCGCCTCCTCAGCCGTCGCCGCCTCGTCACCGCTCTCATCGCTCTC
ATCGCCCTCTACCTCCTCACATGCCTCCTCCGCTCCGTCCCGCCCTTCGCCCGTCCGCTACCGTCCTACTCCGGT
CGCCACGCCGTCGGCTCCGTGGATATCGAAGTGCCGCTTCCCGACGCCCCGCGCCGCATCGCCGGCGTCTTTGAC
CTCGACTCGGTCCTCTTCACCCTCTACCACCCCGTCGCCCACGACTCGTCTTCGGCGCGCCGCCGCCCTTGGATC
GATCGTCCTGTTGGCCCAACTGCCCGCGGATTCGCCCGCCTCCTTGGCCTCGACTTTTTCCTCGTTCGCTGGCTC
TTCACCTTCGTCCTCTGGACCCTCGCCGGCCCGGTGCGCATCCCCGCCGCCGTCGACGCCCCGTTACTCCCTTCC
GACGACCGTCTCCCCGTCATCGTCTTCTCTCACGGCATGGCTTCCTCCCGCACTGACTACACGGCCTACATCGGC
GAGCTCGCTAGCCGCGGCTTCGTCGTCGCCGCCGTGGAGCACCGCGACGGAAGCTGTCCCGGCTCCGTCGTCGCG
CCCGACCGCCCCGTCCTCTCCCTCCGCGGGCCAGACGATCTTCTTCAGTCTAACATCTCCCGCACAGCCTTCAAG
CGCGCCCAGATCACCGTCCGCACCGCCGAGATGCTCGAGACGATCCGCGTCCTGCGCGACCTCGACGCCGGCCAC
GGCCCGGACATGTTCGCCGCCAATGCCCGCCGCGAGGGCGCCCATCTCGCCACCTTTGGCAACCGTCTCGCTCTG
ACCGATGGCCTCGCCCTGGCAGGCCACTCCATGGGCGCAACCGCCGTCCTCCACGCCGTCCATGCCCTCTCCGCC
CCCGTCCCCGTCATCGCCCTCGACCCAGGCAAGCAAAGTGGTCGTCTCTCCCCCGACGACGCGGGAGACGGTCTC
GCATCCCCTTTACTCGTCCTCCACTCCGCTGCCTGGTCTCGACCTTCCACCAGCCTCTTCTACGGCCGTCCTCAC
TTCGACGCCGTCTGTTCCATGGTCCGCGCCGCCCTCGGCCGCTCGTCGTCCGCCTGGTTCCTCACTGGCCTCGAC
ACCGCCCATCCCTCCATTTCCGACGCCCCTCTTCTCGAGCCTCTCCTGCTGCGCTTCGCCACGGGCTTTCGTCTT
CGCGATCCTCTCGCTTCACTGCGAAGACACGCCAATCTTTCCGCCGAGTTTCTTCATCTCTCCGCCGGCCACGCC
AACCACTCTGCTGACCTCCTCCCCGGAAGCCTCCTCGCCGAGTCCGTCACACATTCTACCTTCGGCCACTGGCTG
AGCCCCGGCCGCCGCCGCTCCTTTCCCAAGGACTGGGCTACCCAGTGGGAGATTCACGTCAGCCCAGCCGCCGCC
GAACCCAGACAGATGCACGTCATCAGCCCGCCCGTCCCCGGGTTG
Transcript >Ophio5|1624
ATGGTGGCTGCCGCGCTAAGCAAGCCCCTTGCCGCCGTCTCACCGAGCCTTCGTCCGACCTCCCTCGGCCTCGAG
CTCGATTACCTCGCCGACCCTCCTAGCGACTCCGACCTCGCCCCCGACTCTCCCCTAGCCATCCGCCCCAGATGG
ATGCCTCCGCCTCCCTCGTCGTCGTCGGTCCGCCTCCTCAGCCGTCGCCGCCTCGTCACCGCTCTCATCGCTCTC
ATCGCCCTCTACCTCCTCACATGCCTCCTCCGCTCCGTCCCGCCCTTCGCCCGTCCGCTACCGTCCTACTCCGGT
CGCCACGCCGTCGGCTCCGTGGATATCGAAGTGCCGCTTCCCGACGCCCCGCGCCGCATCGCCGGCGTCTTTGAC
CTCGACTCGGTCCTCTTCACCCTCTACCACCCCGTCGCCCACGACTCGTCTTCGGCGCGCCGCCGCCCTTGGATC
GATCGTCCTGTTGGCCCAACTGCCCGCGGATTCGCCCGCCTCCTTGGCCTCGACTTTTTCCTCGTTCGCTGGCTC
TTCACCTTCGTCCTCTGGACCCTCGCCGGCCCGGTGCGCATCCCCGCCGCCGTCGACGCCCCGTTACTCCCTTCC
GACGACCGTCTCCCCGTCATCGTCTTCTCTCACGGCATGGCTTCCTCCCGCACTGACTACACGGCCTACATCGGC
GAGCTCGCTAGCCGCGGCTTCGTCGTCGCCGCCGTGGAGCACCGCGACGGAAGCTGTCCCGGCTCCGTCGTCGCG
CCCGACCGCCCCGTCCTCTCCCTCCGCGGGCCAGACGATCTTCTTCAGTCTAACATCTCCCGCACAGCCTTCAAG
CGCGCCCAGATCACCGTCCGCACCGCCGAGATGCTCGAGACGATCCGCGTCCTGCGCGACCTCGACGCCGGCCAC
GGCCCGGACATGTTCGCCGCCAATGCCCGCCGCGAGGGCGCCCATCTCGCCACCTTTGGCAACCGTCTCGCTCTG
ACCGATGGCCTCGCCCTGGCAGGCCACTCCATGGGCGCAACCGCCGTCCTCCACGCCGTCCATGCCCTCTCCGCC
CCCGTCCCCGTCATCGCCCTCGACCCAGGCAAGCAAAGTGGTCGTCTCTCCCCCGACGACGCGGGAGACGGTCTC
GCATCCCCTTTACTCGTCCTCCACTCCGCTGCCTGGTCTCGACCTTCCACCAGCCTCTTCTACGGCCGTCCTCAC
TTCGACGCCGTCTGTTCCATGGTCCGCGCCGCCCTCGGCCGCTCGTCGTCCGCCTGGTTCCTCACTGGCCTCGAC
ACCGCCCATCCCTCCATTTCCGACGCCCCTCTTCTCGAGCCTCTCCTGCTGCGCTTCGCCACGGGCTTTCGTCTT
CGCGATCCTCTCGCTTCACTGCGAAGACACGCCAATCTTTCCGCCGAGTTTCTTCATCTCTCCGCCGGCCACGCC
AACCACTCTGCTGACCTCCTCCCCGGAAGCCTCCTCGCCGAGTCCGTCACACATTCTACCTTCGGCCACTGGCTG
AGCCCCGGCCGCCGCCGCTCCTTTCCCAAGGACTGGGCTACCCAGTGGGAGATTCACGTCAGCCCAGCCGCCGCC
GAACCCAGACAGATGCACGTCATCAGCCCGCCCGTCCCCGGGTTGTAA
Gene >Ophio5|1624
ATGGTGGCTGCCGCGCTAAGCAAGCCCCTTGCCGCCGTCTCACCGAGCCTTCGTCCGACCTCGTGCGTCGCTTCA
TGTTTGACCTTCAACCTCGGACAAAACTTTACACCATGACTTCCACCGACAGCCTCGGCCTCGAGCTCGATTACC
TCGCCGACCCTCCTAGCGACTCCGACCTCGCCCCCGACTCTCCCCTAGCCATCCGCCCCAGATGGATGCCTCCGC
CTCCCTCGTCGTCGTCGGTCCGCCTCCTCAGCCGTCGCCGCCTCGTCACCGCTCTCATCGCTCTCATCGCCCTCT
ACCTCCTCACATGCCTCCTCCGCTCCGTCCCGCCCTTCGCCCGTCCGCTACCGTCCTACTCCGGTCGCCACGCCG
TCGGCTCCGTGGATATCGAAGTGCCGCTTCCCGACGCCCCGCGCCGCATCGCCGGCGTCTTTGACCTCGACTCGG
TCCTCTTCACCCTCTACCACCCCGTCGCCCACGACTCGTCTTCGGCGCGCCGCCGCCCTTGGATCGATCGTCCTG
TTGGCCCAACTGCCCGCGGATTCGCCCGCCTCCTTGGCCTCGACTTTTTCCTCGTTCGCTGGCTCTTCACCTTCG
TCCTCTGGACCCTCGCCGGCCCGGTGCGCATCCCCGCCGCCGTCGACGCCCCGTTACTCCCTTCCGACGACCGTC
TCCCCGTCATCGTCTTCTCTCACGGCATGGCTTCCTCCCGCACTGACTACACGGCCTACATCGGCGAGCTCGCTA
GCCGCGGCTTCGTCGTCGCCGCCGTGGAGCACCGCGACGGAAGCTGTCCCGGCTCCGTCGTCGCGCCCGACCGCC
CCGTCCTCTCCCTCCGCGGGCCAGACGATCTTCTTCAGTCTAACATCTCCCGCACAGCCTTCAAGCGCGCCCAGA
TCACCGTCCGCACCGCCGAGATGCTCGAGACGATCCGCGTCCTGCGCGACCTCGACGCCGGCCACGGCCCGGACA
TGTTCGCCGCCAATGCCCGCCGCGAGGGCGCCCATCTCGCCACCTTTGGCAACCGTCTCGCTCTGACCGATGGCC
TCGCCCTGGCAGGCCACTCCATGGGCGCAACCGCCGTCCTCCACGCCGTCCATGCCCTCTCCGCCCCCGTCCCCG
TCATCGCCCTCGACCCAGGCAAGCAAAGTGGTCGTCTCTCCCCCGACGACGCGGGAGACGGTCTCGCATCCCCTT
TACTCGTCCTCCACTCCGCTGCCTGGTCTCGACCTTCCACCAGCCTCTTCTACGGCCGTCCTCACTTCGACGCCG
TCTGTTCCATGGTCCGCGCCGCCCTCGGCCGCTCGTCGTCCGCCTGGTTCCTCACTGGCCTCGACACCGCCCATC
CCTCCATTTCCGACGCCCCTCTTCTCGAGCCTCTCCTGCTGCGCTTCGCCACGGGCTTTCGTCTTCGCGATCCTC
TCGCTTCACTGCGAAGACACGCCAATCTTTCCGCCGAGTTTCTTCATCTCTCCGCCGGCCACGCCAACCACTCTG
CTGACCTCCTCCCCGGAAGCCTCCTCGCCGAGTCCGTCACACATTCTACCTTCGGCCACTGGCTGAGCCCCGGCC
GCCGCCGCTCCTTTCCCAAGGACTGGGCTACCCAGTGGGAGATTCACGTCAGCCCAGCCGCCGCCGAACCCAGAC
AGATGCACGTCATCAGCCCGCCCGTCCCCGGGTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail