Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1620
Gene name
Locationscaffold_16:2888..10937
Strand-
Gene length (bp)8049
Transcript length (bp)7722
Coding sequence length (bp)7719
Protein length (aa) 2573

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02138 Beach Beige/BEACH domain 2.7E-114 1984 2262
PF13385 Laminin_G_3 Concanavalin A-like lectin/glucanases superfamily 8.6E-10 365 485
PF14844 PH_BEACH PH domain associated with Beige/BEACH 1.1E-08 1866 1926

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7LKZ7|BPH1_SCHPO Beige protein homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lvs1 PE=1 SV=2 266 2568 0.0E+00
sp|Q8IZQ1|WDFY3_HUMAN WD repeat and FYVE domain-containing protein 3 OS=Homo sapiens GN=WDFY3 PE=1 SV=2 1377 2516 2.0E-162
sp|Q6VNB8|WDFY3_MOUSE WD repeat and FYVE domain-containing protein 3 OS=Mus musculus GN=Wdfy3 PE=1 SV=1 1377 2516 4.0E-162
sp|P25356|BPH1_YEAST Beige protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPH1 PE=1 SV=2 1640 2547 1.0E-150
sp|Q55DM1|LVSA_DICDI BEACH domain-containing protein lvsA OS=Dictyostelium discoideum GN=lvsA PE=3 SV=2 1745 2515 4.0E-141
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7LKZ7|BPH1_SCHPO Beige protein homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lvs1 PE=1 SV=2 266 2568 0.0E+00
sp|Q8IZQ1|WDFY3_HUMAN WD repeat and FYVE domain-containing protein 3 OS=Homo sapiens GN=WDFY3 PE=1 SV=2 1377 2516 2.0E-162
sp|Q6VNB8|WDFY3_MOUSE WD repeat and FYVE domain-containing protein 3 OS=Mus musculus GN=Wdfy3 PE=1 SV=1 1377 2516 4.0E-162
sp|P25356|BPH1_YEAST Beige protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPH1 PE=1 SV=2 1640 2547 1.0E-150
sp|Q55DM1|LVSA_DICDI BEACH domain-containing protein lvsA OS=Dictyostelium discoideum GN=lvsA PE=3 SV=2 1745 2515 4.0E-141
sp|Q6ZS81|WDFY4_HUMAN WD repeat- and FYVE domain-containing protein 4 OS=Homo sapiens GN=WDFY4 PE=1 SV=3 1655 2516 2.0E-132
sp|F4JHT3|BCHA2_ARATH BEACH domain-containing protein A2 OS=Arabidopsis thaliana GN=BCHA2 PE=3 SV=1 1723 2522 9.0E-132
sp|F4HZB2|BCHA1_ARATH Protein SPIRRIG OS=Arabidopsis thaliana GN=SPI PE=1 SV=1 1723 2522 3.0E-131
sp|Q86JF2|LVSB_DICDI BEACH domain-containing protein lvsB OS=Dictyostelium discoideum GN=lvsB PE=3 SV=1 1877 2533 6.0E-117
sp|Q54U63|LVSC_DICDI BEACH domain-containing protein lvsC OS=Dictyostelium discoideum GN=lvsC PE=3 SV=2 1880 2486 1.0E-94
sp|Q6ZS30|NBEL1_HUMAN Neurobeachin-like protein 1 OS=Homo sapiens GN=NBEAL1 PE=2 SV=3 1678 2279 8.0E-90
sp|E7FAW3|NBEL2_DANRE Neurobeachin-like protein 2 OS=Danio rerio GN=nbeal2 PE=1 SV=1 1890 2271 9.0E-88
sp|F4I9T0|BCHB_ARATH BEACH domain-containing protein B OS=Arabidopsis thaliana GN=BCHB PE=3 SV=1 1880 2560 2.0E-87
sp|Q99698|LYST_HUMAN Lysosomal-trafficking regulator OS=Homo sapiens GN=LYST PE=1 SV=3 1861 2330 2.0E-87
sp|Q9TTK4|LYST_BOVIN Lysosomal-trafficking regulator OS=Bos taurus GN=LYST PE=1 SV=1 1861 2330 2.0E-87
sp|P97412|LYST_MOUSE Lysosomal-trafficking regulator OS=Mus musculus GN=Lyst PE=1 SV=1 1861 2262 3.0E-87
sp|Q9W4E2|NBEA_DROME Neurobeachin OS=Drosophila melanogaster GN=rg PE=1 SV=3 1882 2428 3.0E-87
sp|Q6ZNJ1|NBEL2_HUMAN Neurobeachin-like protein 2 OS=Homo sapiens GN=NBEAL2 PE=1 SV=2 1634 2272 2.0E-86
sp|P50851|LRBA_HUMAN Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens GN=LRBA PE=1 SV=4 1882 2493 8.0E-86
sp|Q6ZQA0|NBEL2_MOUSE Neurobeachin-like protein 2 OS=Mus musculus GN=Nbeal2 PE=1 SV=2 1633 2274 1.0E-85
sp|Q9EPN1|NBEA_MOUSE Neurobeachin OS=Mus musculus GN=Nbea PE=1 SV=1 1882 2262 7.0E-85
sp|Q8NFP9|NBEA_HUMAN Neurobeachin OS=Homo sapiens GN=NBEA PE=1 SV=3 1882 2262 3.0E-84
sp|Q9ESE1|LRBA_MOUSE Lipopolysaccharide-responsive and beige-like anchor protein OS=Mus musculus GN=Lrba PE=1 SV=1 1882 2493 3.0E-84
sp|Q54RQ8|LVSE_DICDI BEACH domain-containing protein lvsE OS=Dictyostelium discoideum GN=lvsE PE=3 SV=1 1882 2266 3.0E-83
sp|Q55AV3|LVSD_DICDI BEACH domain-containing protein lvsD OS=Dictyostelium discoideum GN=lvsD PE=3 SV=2 1878 2426 1.0E-82
sp|F4IG73|BCHC2_ARATH BEACH domain-containing protein C2 OS=Arabidopsis thaliana GN=BCHC2 PE=1 SV=1 1872 2262 8.0E-81
sp|Q92636|FAN_HUMAN Protein FAN OS=Homo sapiens GN=NSMAF PE=1 SV=2 1982 2568 2.0E-77
sp|Q54PP7|LVSF_DICDI BEACH domain-containing protein lvsF OS=Dictyostelium discoideum GN=lvsF PE=3 SV=1 1853 2262 9.0E-77
sp|Q19317|NBEA_CAEEL Putative neurobeachin homolog OS=Caenorhabditis elegans GN=sel-2 PE=2 SV=3 1878 2428 9.0E-73
sp|O35242|FAN_MOUSE Protein FAN OS=Mus musculus GN=Nsmaf PE=1 SV=2 1885 2478 5.0E-72
sp|A8XSV3|NBEA_CAEBR Putative neurobeachin homolog OS=Caenorhabditis briggsae GN=sel-2 PE=3 SV=1 1878 2428 9.0E-72
sp|F4JD14|BCHC1_ARATH BEACH domain-containing protein C1 OS=Arabidopsis thaliana GN=BCHC1 PE=1 SV=1 1867 2131 7.0E-38
sp|Q55DM1|LVSA_DICDI BEACH domain-containing protein lvsA OS=Dictyostelium discoideum GN=lvsA PE=3 SV=2 17 1034 3.0E-26
sp|F4JY12|GFS12_ARATH Protein GFS12 OS=Arabidopsis thaliana GN=GFS12 PE=1 SV=1 1978 2262 1.0E-23
sp|Q8IZQ1|WDFY3_HUMAN WD repeat and FYVE domain-containing protein 3 OS=Homo sapiens GN=WDFY3 PE=1 SV=2 353 902 7.0E-22
sp|Q6VNB8|WDFY3_MOUSE WD repeat and FYVE domain-containing protein 3 OS=Mus musculus GN=Wdfy3 PE=1 SV=1 353 902 8.0E-21
sp|Q562E7|WDR81_HUMAN WD repeat-containing protein 81 OS=Homo sapiens GN=WDR81 PE=1 SV=2 1985 2262 1.0E-18
sp|Q5ND34|WDR81_MOUSE WD repeat-containing protein 81 OS=Mus musculus GN=Wdr81 PE=1 SV=2 1985 2262 2.0E-18
sp|D4A929|WDR81_RAT WD repeat-containing protein 81 OS=Rattus norvegicus GN=Wdr81 PE=3 SV=1 1985 2262 1.0E-17
sp|P97412|LYST_MOUSE Lysosomal-trafficking regulator OS=Mus musculus GN=Lyst PE=1 SV=1 2318 2566 1.0E-15
sp|Q99698|LYST_HUMAN Lysosomal-trafficking regulator OS=Homo sapiens GN=LYST PE=1 SV=3 2318 2566 1.0E-15
sp|Q9TTK4|LYST_BOVIN Lysosomal-trafficking regulator OS=Bos taurus GN=LYST PE=1 SV=1 2318 2566 3.0E-15
sp|F4HZB2|BCHA1_ARATH Protein SPIRRIG OS=Arabidopsis thaliana GN=SPI PE=1 SV=1 74 760 9.0E-13
sp|F4JHT3|BCHA2_ARATH BEACH domain-containing protein A2 OS=Arabidopsis thaliana GN=BCHA2 PE=3 SV=1 284 761 4.0E-10
sp|Q6ZS81|WDFY4_HUMAN WD repeat- and FYVE domain-containing protein 4 OS=Homo sapiens GN=WDFY4 PE=1 SV=3 295 911 4.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1620
MAFHPRRRRASTSVSLQPTSDSFQLLCGLLDSLVDDAASLGADGYPQVDSLVGHLRLVSRHVVTSSSPAVADDFR
HAHGFESVLGALRHFSGYYDPRKRDESEMLSLFTLLGACLDLLSAALRDNSTNRRFFRHRVEGGGWEALEQVIAS
IGLGGAELDPWVSCNAFGKLLSFSLEDEGLDLLCQSVAQALRPEASGTLSRSEDDEQWELILARSVENIGPAVRE
VVTPGTIVRFPEILRAVVSFWTAIPRPHGSSASPSSVLVLETMLRIVSVSFYNRAAVHSTGVLSQLLRVAFGKGT
WLAEPERERLLAVCRLLMALGVNQPADTQFLLSAPGAEASDFCLEMMSEHTGPPFFQFDLSLHGYSSLELPSLGR
AFPPQSSAGYTFAAWIRVDTFDPSAHTTIFGLYDSSQTCFLLLYLERDTQNLILQTSVHSSKPSVRLKSVVFREQ
KWYHVAVVHKRPKTMVASKALLYVNGDFAEQVRCSYPRSPPLSNGSVESFATLNPSQSRTNPVQAFLGTPRDLAG
RTGPGVVVSKWSLASAHLFEEVMSDDYLAVHYGLGPRYQGNFQDSLGGFQTYEASATLGLRNELVHPGKDENSDI
LRAVRDKASSLLPESKILLSALPTGTFPEHVQFLDTGVLRSLPRVSVRNLVHMSNQEGAPLAVNCAVSSLSDALM
RTNGIASLCGTPIVALPSHLDENLWRLAGFTPLALKLLERASTAEELIRAVEIMFHCIRRSWRNSEAMERDNGYG
ILGMILRFKIGYGNYASGDAPISRLSISNEDRDSLAFRVLSLILDFVGYNHMEPIESFIVNPLAYRILLIDLDIW
RRSANRTQELFYKQFVTFAVNSKHHEFNSRRLVRMRVVKRLLDSTKGEGVSEEVVDHFMNAFEALVKSNLSQEVM
RFMSLFITYAFHTCPPSASRTPKASSTSHLSISGLARRLTGDVNRTRSPSAVGTRVLSKKQLGIRVLAMYAGILC
EKGSFNNIKKFARTVTNKWLLYLLADDDAAVVLHGSMILSRLLVAHGSSYTSKFTGKSGGFTIMATRLKRFWDIP
TLWTICFSILFGYDIAELDLDRDFDVDNLLGMFVKRKVVHPESLVVITSLLQHGIKEVMRYQEDPDSPAKVDGSP
AARRARPKPETGPRVLSMNPTKALEARTSLHYPLDRVTGRVDILQTSIGFLQELHARSSSFRDFSLSSEWVRTLL
LALYPAIVGSDAVTPEAELNSRDSVLTFEGSDVIIRPIAGVQAAAPIVRTSHVHVMPSPQATPPKGTPLRRASSF
VLLTAQTASRVDDGLSAPSPQTQARQSSGGILSEGMLELLVAVFLDQIFARKDFTSFGLSSNVPPGFQEHQAYLK
SYILRRVIARVSDHIHGNRKTICEPRILTNLSRLCLHISEAIFEGWFMDGAEVMIDFNGMLLEQLQRPDICKMKS
VRLCSQAVTVIRNCFLRIVLLRLSDLDDDRVTEREAKDFMNKLAYWQMSILECFNVDDEYLRLFWYQLYTKLIDD
KWSVRIAAANFLRIVQVQKPEESVAIVRSCMTPDQKKLSREFQKLTEVDDETFVAWVDQHRPSLDQLFLGNMAKT
WEDFVSSEYHKSLETAKSRVSKRKERLQAWHVEAISTDKILLSHAVGNSAWMKSIYNTEHFKYQRLLQDQQDDLS
FLMAGYSKMERDLRRPGAVFSEPASTKWKLDRTEGRNRMRLRLLPDSPATEEKYRPKRKGAEARAQTPINTPASN
GRHEARPPSTNLELDVNDETTTVNAEGATRTETTETGCAPEDDFELVQDPNDPVEGDENFEDKNRKVMRRLEQGE
QVQAAYNMSRITGLEACEGLLIVGKDALYIMDNVFQCASGEIVDVWQAPAEERDPFSMVVTGAKTLEKRQNSGAR
DQESRHWRWHDVISVSKRRFLFRDVAIEVFFTDGRSYLLTTINPAIRDELFAKMLAKAGPNAVPNPEDGWRLGAL
KTAENELPQGFGAGLGSKLGTLFNAAPWNPAMRRWQRGELSNFHYLMMVNTMAGRTFNDLTQYPVFPWILADYSS
EELDLDDPVTFRDLSKPMGGQTQGRVAGFVETYKALQEIDQTPFHYGTHYSSAMIVSSYLIRLPPFVQSYLLVQG
DSFDHADRLFQSIGDAWESASCRNKTDVRELIPEFFCLPEFLTNINGYDFGHRQSNGVKVDNVALPPWAKGDPKI
FIARHREALESRYVSENLHHWIDLVFGCKQRGEAAVESLNVFHHLSYAGASDLDRITDANERAITAGVIHNFGQT
PHQVFSKPHPARENMRCPTRRLDTAVFSLSRSDHPMLESHERVASLVYVTKSDRLLCASPLRLNLPPYDKFLEWG
YADGSVRFFFSDNRKPAGLFENLHIGQISCACFADSKTLITAGEDCVVSVYSVLTAPGKQVELVPRSSVFGHKTP
VTAMAVSKAVSTFVTASSDGQAFLWDLNRLSFIRKLPLVRQVECARINDVSGDIMLCSGPNVVLYTLNGSLLLEQ
KVCEGDDYVHSCAFYEGAGDEWLEDQLVFTGHGGGRVKVWRKCWTTDGRWTLELLRQLDHGGGEKAAGITCITPM
PSCLYTGDDDGRVFEWGLGRGER
Coding >Ophio5|1620
ATGGCCTTTCATCCTCGACGCCGGCGGGCTTCAACCTCGGTCTCGTTGCAGCCGACGTCCGATTCTTTCCAGCTG
CTGTGCGGTCTGCTCGACAGCCTGGTTGACGACGCCGCCTCGTTGGGAGCCGACGGATATCCCCAAGTCGACAGC
CTCGTCGGGCACCTTAGGCTCGTTTCTCGCCATGTCGTCACTTCTTCGTCGCCTGCAGTTGCGGACGACTTTCGA
CACGCTCACGGCTTCGAGTCTGTTCTCGGCGCTCTTCGCCATTTCTCGGGCTACTATGACCCCCGCAAGAGAGAC
GAATCCGAGATGCTCTCCCTCTTTACCTTGCTCGGCGCCTGTCTCGATCTCCTTTCGGCCGCGCTGAGGGACAAC
TCGACCAACAGGCGGTTTTTTCGCCATCGTGTCGAGGGTGGCGGATGGGAGGCTCTTGAGCAGGTCATAGCGAGC
ATTGGCCTCGGCGGCGCTGAGCTGGATCCTTGGGTCAGCTGCAACGCCTTTGGCAAACTTCTCTCCTTTTCACTG
GAGGACGAAGGTCTCGATCTTCTCTGCCAGTCCGTCGCCCAGGCGCTGCGGCCCGAGGCTTCTGGCACTTTGAGC
CGCTCCGAAGATGACGAGCAGTGGGAGCTCATCCTGGCCCGCTCCGTCGAGAACATTGGCCCCGCGGTGCGGGAG
GTGGTTACTCCCGGGACCATAGTCCGCTTTCCGGAGATCCTCAGAGCAGTCGTGAGCTTCTGGACGGCCATACCG
CGACCGCATGGCTCGTCGGCAAGTCCCAGCTCCGTCCTCGTGCTCGAGACGATGCTGCGAATAGTCTCCGTCTCC
TTTTACAACCGCGCCGCCGTTCACTCCACCGGAGTCTTGTCCCAACTGCTACGTGTGGCCTTTGGAAAAGGCACG
TGGCTCGCCGAGCCCGAACGCGAGAGGCTGTTGGCCGTATGCCGGCTGCTCATGGCTCTTGGCGTGAATCAGCCG
GCTGATACGCAGTTTCTCCTCTCTGCCCCCGGAGCCGAAGCCTCCGACTTTTGTCTCGAGATGATGTCCGAACAC
ACGGGCCCGCCCTTCTTCCAGTTCGACCTGTCACTCCACGGATACTCGTCTCTCGAGCTGCCGAGCCTCGGCCGC
GCATTTCCCCCGCAGTCGAGTGCCGGCTACACCTTCGCCGCCTGGATCCGCGTTGACACGTTCGATCCGTCCGCC
CACACAACCATCTTTGGCCTCTACGACTCCTCGCAGACCTGTTTTTTGCTGCTGTATCTGGAACGAGACACTCAA
AACCTCATCCTCCAAACCTCGGTTCATTCCAGCAAGCCAAGTGTGAGGCTCAAGTCAGTCGTGTTCCGCGAGCAG
AAGTGGTATCACGTCGCCGTCGTTCATAAGAGGCCCAAGACTATGGTCGCCAGCAAGGCGCTGCTGTACGTCAAT
GGGGATTTCGCCGAGCAGGTCCGCTGCAGCTACCCTCGCTCGCCGCCGCTCTCGAATGGCAGCGTCGAGAGCTTC
GCGACCTTAAACCCAAGCCAGAGCAGGACAAATCCCGTCCAGGCCTTCCTCGGCACGCCTCGCGACTTGGCTGGC
CGCACGGGACCGGGTGTTGTCGTCTCCAAGTGGTCGCTTGCCTCGGCCCATCTCTTCGAGGAGGTCATGAGCGAT
GATTACCTGGCCGTCCACTACGGCCTGGGTCCTCGATACCAGGGCAACTTTCAGGATAGTCTCGGAGGCTTTCAG
ACGTACGAGGCGTCCGCCACCTTGGGTCTCCGCAACGAGCTGGTACACCCGGGCAAGGATGAGAACTCGGACATT
CTTCGAGCTGTGCGCGACAAGGCAAGCTCCCTACTGCCAGAATCCAAGATACTTCTCAGCGCCCTCCCCACCGGA
ACCTTTCCCGAGCACGTGCAGTTTCTCGATACCGGCGTTTTGCGCTCGCTGCCTCGCGTGTCTGTACGCAATCTC
GTCCACATGTCCAACCAAGAGGGCGCCCCATTGGCCGTGAATTGTGCCGTCTCTAGCCTGTCAGATGCCCTCATG
AGGACCAATGGAATCGCTTCCCTTTGCGGGACTCCCATCGTTGCCCTGCCGTCGCACCTGGATGAGAATCTCTGG
CGTCTCGCCGGCTTCACGCCGCTGGCTCTCAAGCTGCTTGAGAGGGCTTCGACGGCGGAGGAGCTTATTCGCGCA
GTTGAAATAATGTTTCACTGCATACGCAGGAGTTGGCGTAACAGTGAAGCCATGGAAAGAGACAATGGATACGGC
ATCCTGGGCATGATCCTCCGCTTCAAAATTGGGTACGGCAACTACGCTTCGGGAGACGCGCCGATTTCTCGTCTC
TCGATATCAAACGAGGACCGCGATAGCCTGGCGTTTCGGGTGCTGAGTCTCATCCTCGACTTTGTCGGCTACAAC
CACATGGAGCCCATCGAGTCCTTCATTGTCAACCCCCTCGCTTACCGGATACTCCTCATCGACTTGGACATCTGG
AGACGATCCGCCAACCGCACCCAGGAGCTCTTTTACAAGCAGTTTGTGACATTTGCCGTTAACAGCAAGCACCAC
GAGTTCAACAGCAGGAGGTTGGTACGCATGCGGGTCGTGAAGAGGTTGCTCGACTCCACAAAGGGGGAGGGGGTA
TCCGAAGAAGTTGTCGACCACTTCATGAATGCCTTTGAAGCACTTGTCAAATCCAATCTCAGCCAGGAAGTCATG
AGGTTCATGTCCTTGTTCATCACCTACGCCTTTCACACCTGCCCGCCTTCGGCATCGCGGACGCCAAAAGCGTCC
TCCACGTCACACTTGAGCATCTCAGGCCTCGCTAGGCGGCTGACCGGGGATGTCAACAGGACGCGCAGTCCTTCG
GCGGTCGGAACTAGGGTGCTGTCTAAGAAGCAGCTCGGAATCCGTGTGCTGGCCATGTATGCCGGAATTTTGTGC
GAAAAGGGCAGCTTCAATAACATCAAGAAATTCGCCAGAACCGTCACCAACAAGTGGCTCCTCTACCTGCTGGCG
GATGACGACGCCGCGGTGGTCCTCCATGGGTCCATGATCCTCTCTAGGCTGCTCGTCGCCCATGGATCTTCGTAC
ACGTCCAAGTTCACGGGAAAGTCTGGCGGTTTCACCATCATGGCGACTCGGCTCAAGAGGTTCTGGGACATTCCC
ACGCTTTGGACGATATGCTTTAGCATCTTGTTTGGGTACGACATTGCTGAGCTTGACCTTGATCGTGACTTTGAT
GTAGACAACCTGCTCGGCATGTTTGTCAAGCGGAAGGTGGTCCATCCCGAAAGCCTGGTTGTCATCACATCGTTG
CTCCAGCACGGTATCAAGGAGGTCATGAGGTATCAGGAGGATCCAGACTCGCCGGCCAAGGTGGATGGCTCGCCT
GCTGCAAGGAGGGCCAGGCCGAAGCCCGAGACTGGGCCTCGAGTCCTGTCCATGAACCCGACCAAGGCACTCGAA
GCTCGAACGAGTCTGCATTACCCCCTCGATAGGGTCACCGGGCGTGTCGACATATTGCAGACGTCGATCGGGTTC
CTACAAGAGCTTCACGCTCGGTCGTCCAGCTTCCGAGACTTTTCCTTGTCATCCGAATGGGTTCGCACGCTGCTT
TTGGCTCTCTATCCCGCCATCGTCGGCTCGGATGCGGTTACGCCGGAAGCTGAGCTGAATTCACGGGATTCCGTG
CTCACATTTGAGGGCAGCGACGTCATCATCAGGCCTATAGCAGGCGTTCAGGCAGCCGCTCCGATCGTACGCACG
AGCCACGTCCATGTGATGCCATCGCCGCAAGCAACACCTCCCAAGGGCACCCCTCTCCGCCGGGCATCTTCCTTT
GTCCTCCTGACGGCGCAGACGGCATCTCGCGTTGACGACGGCCTCTCCGCTCCCTCGCCGCAGACTCAGGCTCGA
CAGAGCAGCGGCGGTATTCTGTCCGAGGGGATGCTAGAACTGCTGGTCGCCGTATTCCTCGACCAGATATTTGCG
CGCAAGGACTTTACTAGTTTTGGCCTCTCCAGCAATGTGCCGCCGGGCTTCCAGGAGCACCAAGCCTATCTCAAG
TCATACATACTCAGGAGGGTGATTGCTCGCGTGTCGGACCACATTCATGGCAACAGAAAGACCATCTGCGAGCCT
CGCATTCTGACCAACTTGTCGCGGCTCTGCTTGCACATATCGGAAGCCATCTTCGAGGGCTGGTTCATGGACGGG
GCGGAGGTGATGATTGATTTTAACGGCATGTTGCTGGAGCAGCTTCAGCGGCCCGACATCTGCAAGATGAAGAGC
GTACGACTGTGCAGTCAGGCCGTCACCGTGATTCGTAACTGCTTCCTCAGGATCGTCCTGCTGAGGCTCTCGGAC
CTGGACGACGATCGGGTCACGGAGAGGGAGGCCAAGGACTTTATGAACAAGCTCGCCTACTGGCAAATGTCTATA
CTCGAGTGCTTCAACGTGGACGATGAGTACCTGAGGCTGTTTTGGTATCAGCTCTACACGAAGCTCATCGACGAC
AAATGGTCCGTACGCATCGCCGCGGCCAACTTTCTGCGCATCGTCCAGGTGCAGAAGCCCGAGGAGTCGGTTGCC
ATAGTGCGTTCGTGCATGACGCCGGACCAGAAGAAGCTGTCGAGAGAATTCCAGAAGCTCACCGAGGTGGACGAC
GAGACGTTTGTCGCCTGGGTGGATCAGCACCGGCCATCGCTGGATCAGCTTTTCCTCGGGAACATGGCGAAGACG
TGGGAGGACTTCGTCAGCTCGGAGTACCACAAGTCCCTCGAAACCGCCAAAAGTCGCGTGTCTAAGCGCAAGGAG
AGGCTTCAGGCGTGGCATGTGGAGGCCATCAGCACGGACAAGATTCTTCTCAGCCATGCGGTGGGCAACAGCGCG
TGGATGAAGAGCATCTACAACACGGAGCATTTCAAGTACCAGCGTCTTTTGCAAGACCAGCAGGATGACTTGTCC
TTCCTCATGGCCGGCTACAGCAAGATGGAGAGGGACCTCAGGAGACCGGGCGCGGTATTCAGCGAGCCGGCCTCG
ACCAAGTGGAAGCTGGACCGGACCGAGGGGCGCAACCGGATGCGGCTGAGGCTGCTGCCGGATTCGCCCGCGACC
GAAGAGAAATACCGGCCGAAGAGAAAAGGGGCTGAAGCGCGGGCCCAGACACCGATCAACACGCCGGCTTCGAAC
GGCCGTCACGAGGCGCGGCCGCCGTCGACCAACTTGGAACTTGATGTCAACGACGAGACGACGACTGTCAACGCC
GAGGGCGCGACAAGAACGGAAACAACGGAGACGGGATGCGCTCCTGAAGACGACTTTGAGCTCGTTCAAGACCCC
AATGATCCTGTCGAGGGCGACGAGAACTTCGAAGATAAGAACCGCAAGGTGATGCGGCGGCTCGAGCAGGGCGAG
CAAGTACAGGCTGCCTATAACATGTCTCGCATCACCGGCCTCGAGGCTTGCGAGGGCCTTCTCATCGTGGGAAAG
GACGCGCTGTACATCATGGACAACGTGTTCCAATGCGCGAGCGGAGAAATCGTCGATGTGTGGCAGGCCCCGGCT
GAGGAACGAGACCCCTTCAGCATGGTCGTGACGGGGGCCAAGACGCTGGAGAAACGGCAGAACTCGGGAGCCAGG
GATCAAGAATCGAGGCACTGGCGCTGGCACGACGTTATCAGCGTTTCCAAGCGTCGTTTTCTCTTTCGAGACGTT
GCCATCGAGGTCTTCTTCACAGACGGGCGTAGCTATCTCCTGACGACCATCAATCCGGCCATCAGAGACGAGCTG
TTCGCCAAGATGCTCGCCAAGGCGGGACCCAACGCGGTCCCGAACCCGGAGGATGGCTGGCGGCTGGGGGCGCTG
AAGACGGCGGAGAACGAGCTGCCTCAGGGGTTCGGGGCGGGCCTGGGCTCCAAGCTCGGCACGCTGTTCAACGCG
GCGCCGTGGAACCCGGCGATGCGGCGGTGGCAGCGGGGAGAGCTGTCCAACTTTCACTACCTCATGATGGTCAAC
ACCATGGCTGGGCGGACATTCAACGACCTGACGCAGTACCCGGTCTTCCCCTGGATTCTGGCCGACTACAGCAGC
GAGGAGCTAGACCTGGATGATCCGGTCACGTTCCGCGATCTCTCGAAGCCAATGGGCGGCCAAACGCAGGGCCGG
GTGGCGGGTTTCGTCGAGACATACAAGGCACTGCAAGAAATTGACCAGACGCCGTTTCACTATGGCACGCACTAC
TCGTCGGCCATGATCGTGTCGTCATACCTGATCCGGCTGCCGCCGTTTGTGCAGTCATATCTGCTGGTTCAGGGT
GACAGCTTCGACCACGCCGACCGTCTATTTCAGTCCATAGGGGACGCGTGGGAGTCGGCGTCGTGTCGGAACAAG
ACGGACGTCCGGGAGCTGATCCCCGAGTTCTTTTGTTTGCCCGAGTTCCTGACCAACATCAACGGCTACGACTTT
GGCCACCGTCAGAGCAACGGCGTCAAGGTGGACAATGTGGCGCTACCGCCGTGGGCCAAGGGGGACCCCAAGATC
TTCATTGCACGGCACCGCGAGGCTCTCGAGAGCCGGTATGTCAGCGAGAATCTACATCACTGGATCGACCTCGTC
TTCGGCTGCAAACAGCGGGGCGAGGCGGCTGTGGAGAGCCTCAACGTCTTCCACCACCTGTCGTATGCGGGCGCC
AGCGACCTGGACCGCATTACAGACGCCAACGAGAGGGCCATCACGGCGGGCGTCATTCACAACTTTGGGCAGACG
CCGCATCAGGTGTTTAGCAAACCGCACCCGGCGAGGGAGAATATGCGCTGTCCGACCAGGAGGCTTGATACGGCC
GTGTTTTCGTTGAGCCGGTCGGATCATCCGATGCTGGAGAGCCACGAGCGAGTGGCATCACTGGTCTATGTGACC
AAGTCGGATCGATTACTATGCGCTTCGCCGCTTCGCCTCAATCTTCCCCCCTATGACAAGTTTCTCGAATGGGGC
TACGCCGACGGCAGCGTCCGCTTCTTCTTTAGCGACAACCGCAAGCCGGCCGGGCTCTTCGAGAACCTACACATT
GGACAAATCTCATGTGCCTGTTTTGCCGACTCCAAGACGCTCATCACGGCGGGCGAGGACTGCGTCGTCTCGGTC
TACTCGGTGCTCACGGCGCCAGGGAAGCAGGTAGAGCTCGTCCCGCGGTCGAGCGTCTTCGGCCACAAGACGCCC
GTGACGGCCATGGCAGTAAGCAAGGCTGTGAGCACATTTGTGACGGCCTCTTCGGACGGGCAGGCCTTTTTATGG
GATCTCAACCGGTTGTCGTTTATACGCAAGCTGCCGTTGGTGCGACAGGTCGAGTGCGCGCGCATCAACGACGTC
TCGGGTGACATAATGCTCTGCTCAGGACCAAACGTGGTGCTGTACACGCTCAACGGTTCGCTGCTCCTGGAGCAA
AAGGTGTGCGAAGGGGATGACTACGTGCACTCGTGTGCCTTTTACGAGGGCGCGGGCGACGAGTGGCTCGAGGAC
CAGCTGGTCTTTACAGGCCATGGCGGCGGACGCGTCAAAGTTTGGCGCAAGTGCTGGACCACGGATGGCCGATGG
ACGCTCGAGCTGCTGCGGCAGTTGGACCACGGTGGGGGAGAGAAGGCGGCGGGCATCACCTGCATCACGCCGATG
CCAAGTTGTCTTTACACGGGGGATGACGACGGCCGAGTGTTTGAATGGGGCCTCGGACGCGGCGAGAGA
Transcript >Ophio5|1620
ATGGCCTTTCATCCTCGACGCCGGCGGGCTTCAACCTCGGTCTCGTTGCAGCCGACGTCCGATTCTTTCCAGCTG
CTGTGCGGTCTGCTCGACAGCCTGGTTGACGACGCCGCCTCGTTGGGAGCCGACGGATATCCCCAAGTCGACAGC
CTCGTCGGGCACCTTAGGCTCGTTTCTCGCCATGTCGTCACTTCTTCGTCGCCTGCAGTTGCGGACGACTTTCGA
CACGCTCACGGCTTCGAGTCTGTTCTCGGCGCTCTTCGCCATTTCTCGGGCTACTATGACCCCCGCAAGAGAGAC
GAATCCGAGATGCTCTCCCTCTTTACCTTGCTCGGCGCCTGTCTCGATCTCCTTTCGGCCGCGCTGAGGGACAAC
TCGACCAACAGGCGGTTTTTTCGCCATCGTGTCGAGGGTGGCGGATGGGAGGCTCTTGAGCAGGTCATAGCGAGC
ATTGGCCTCGGCGGCGCTGAGCTGGATCCTTGGGTCAGCTGCAACGCCTTTGGCAAACTTCTCTCCTTTTCACTG
GAGGACGAAGGTCTCGATCTTCTCTGCCAGTCCGTCGCCCAGGCGCTGCGGCCCGAGGCTTCTGGCACTTTGAGC
CGCTCCGAAGATGACGAGCAGTGGGAGCTCATCCTGGCCCGCTCCGTCGAGAACATTGGCCCCGCGGTGCGGGAG
GTGGTTACTCCCGGGACCATAGTCCGCTTTCCGGAGATCCTCAGAGCAGTCGTGAGCTTCTGGACGGCCATACCG
CGACCGCATGGCTCGTCGGCAAGTCCCAGCTCCGTCCTCGTGCTCGAGACGATGCTGCGAATAGTCTCCGTCTCC
TTTTACAACCGCGCCGCCGTTCACTCCACCGGAGTCTTGTCCCAACTGCTACGTGTGGCCTTTGGAAAAGGCACG
TGGCTCGCCGAGCCCGAACGCGAGAGGCTGTTGGCCGTATGCCGGCTGCTCATGGCTCTTGGCGTGAATCAGCCG
GCTGATACGCAGTTTCTCCTCTCTGCCCCCGGAGCCGAAGCCTCCGACTTTTGTCTCGAGATGATGTCCGAACAC
ACGGGCCCGCCCTTCTTCCAGTTCGACCTGTCACTCCACGGATACTCGTCTCTCGAGCTGCCGAGCCTCGGCCGC
GCATTTCCCCCGCAGTCGAGTGCCGGCTACACCTTCGCCGCCTGGATCCGCGTTGACACGTTCGATCCGTCCGCC
CACACAACCATCTTTGGCCTCTACGACTCCTCGCAGACCTGTTTTTTGCTGCTGTATCTGGAACGAGACACTCAA
AACCTCATCCTCCAAACCTCGGTTCATTCCAGCAAGCCAAGTGTGAGGCTCAAGTCAGTCGTGTTCCGCGAGCAG
AAGTGGTATCACGTCGCCGTCGTTCATAAGAGGCCCAAGACTATGGTCGCCAGCAAGGCGCTGCTGTACGTCAAT
GGGGATTTCGCCGAGCAGGTCCGCTGCAGCTACCCTCGCTCGCCGCCGCTCTCGAATGGCAGCGTCGAGAGCTTC
GCGACCTTAAACCCAAGCCAGAGCAGGACAAATCCCGTCCAGGCCTTCCTCGGCACGCCTCGCGACTTGGCTGGC
CGCACGGGACCGGGTGTTGTCGTCTCCAAGTGGTCGCTTGCCTCGGCCCATCTCTTCGAGGAGGTCATGAGCGAT
GATTACCTGGCCGTCCACTACGGCCTGGGTCCTCGATACCAGGGCAACTTTCAGGATAGTCTCGGAGGCTTTCAG
ACGTACGAGGCGTCCGCCACCTTGGGTCTCCGCAACGAGCTGGTACACCCGGGCAAGGATGAGAACTCGGACATT
CTTCGAGCTGTGCGCGACAAGGCAAGCTCCCTACTGCCAGAATCCAAGATACTTCTCAGCGCCCTCCCCACCGGA
ACCTTTCCCGAGCACGTGCAGTTTCTCGATACCGGCGTTTTGCGCTCGCTGCCTCGCGTGTCTGTACGCAATCTC
GTCCACATGTCCAACCAAGAGGGCGCCCCATTGGCCGTGAATTGTGCCGTCTCTAGCCTGTCAGATGCCCTCATG
AGGACCAATGGAATCGCTTCCCTTTGCGGGACTCCCATCGTTGCCCTGCCGTCGCACCTGGATGAGAATCTCTGG
CGTCTCGCCGGCTTCACGCCGCTGGCTCTCAAGCTGCTTGAGAGGGCTTCGACGGCGGAGGAGCTTATTCGCGCA
GTTGAAATAATGTTTCACTGCATACGCAGGAGTTGGCGTAACAGTGAAGCCATGGAAAGAGACAATGGATACGGC
ATCCTGGGCATGATCCTCCGCTTCAAAATTGGGTACGGCAACTACGCTTCGGGAGACGCGCCGATTTCTCGTCTC
TCGATATCAAACGAGGACCGCGATAGCCTGGCGTTTCGGGTGCTGAGTCTCATCCTCGACTTTGTCGGCTACAAC
CACATGGAGCCCATCGAGTCCTTCATTGTCAACCCCCTCGCTTACCGGATACTCCTCATCGACTTGGACATCTGG
AGACGATCCGCCAACCGCACCCAGGAGCTCTTTTACAAGCAGTTTGTGACATTTGCCGTTAACAGCAAGCACCAC
GAGTTCAACAGCAGGAGGTTGGTACGCATGCGGGTCGTGAAGAGGTTGCTCGACTCCACAAAGGGGGAGGGGGTA
TCCGAAGAAGTTGTCGACCACTTCATGAATGCCTTTGAAGCACTTGTCAAATCCAATCTCAGCCAGGAAGTCATG
AGGTTCATGTCCTTGTTCATCACCTACGCCTTTCACACCTGCCCGCCTTCGGCATCGCGGACGCCAAAAGCGTCC
TCCACGTCACACTTGAGCATCTCAGGCCTCGCTAGGCGGCTGACCGGGGATGTCAACAGGACGCGCAGTCCTTCG
GCGGTCGGAACTAGGGTGCTGTCTAAGAAGCAGCTCGGAATCCGTGTGCTGGCCATGTATGCCGGAATTTTGTGC
GAAAAGGGCAGCTTCAATAACATCAAGAAATTCGCCAGAACCGTCACCAACAAGTGGCTCCTCTACCTGCTGGCG
GATGACGACGCCGCGGTGGTCCTCCATGGGTCCATGATCCTCTCTAGGCTGCTCGTCGCCCATGGATCTTCGTAC
ACGTCCAAGTTCACGGGAAAGTCTGGCGGTTTCACCATCATGGCGACTCGGCTCAAGAGGTTCTGGGACATTCCC
ACGCTTTGGACGATATGCTTTAGCATCTTGTTTGGGTACGACATTGCTGAGCTTGACCTTGATCGTGACTTTGAT
GTAGACAACCTGCTCGGCATGTTTGTCAAGCGGAAGGTGGTCCATCCCGAAAGCCTGGTTGTCATCACATCGTTG
CTCCAGCACGGTATCAAGGAGGTCATGAGGTATCAGGAGGATCCAGACTCGCCGGCCAAGGTGGATGGCTCGCCT
GCTGCAAGGAGGGCCAGGCCGAAGCCCGAGACTGGGCCTCGAGTCCTGTCCATGAACCCGACCAAGGCACTCGAA
GCTCGAACGAGTCTGCATTACCCCCTCGATAGGGTCACCGGGCGTGTCGACATATTGCAGACGTCGATCGGGTTC
CTACAAGAGCTTCACGCTCGGTCGTCCAGCTTCCGAGACTTTTCCTTGTCATCCGAATGGGTTCGCACGCTGCTT
TTGGCTCTCTATCCCGCCATCGTCGGCTCGGATGCGGTTACGCCGGAAGCTGAGCTGAATTCACGGGATTCCGTG
CTCACATTTGAGGGCAGCGACGTCATCATCAGGCCTATAGCAGGCGTTCAGGCAGCCGCTCCGATCGTACGCACG
AGCCACGTCCATGTGATGCCATCGCCGCAAGCAACACCTCCCAAGGGCACCCCTCTCCGCCGGGCATCTTCCTTT
GTCCTCCTGACGGCGCAGACGGCATCTCGCGTTGACGACGGCCTCTCCGCTCCCTCGCCGCAGACTCAGGCTCGA
CAGAGCAGCGGCGGTATTCTGTCCGAGGGGATGCTAGAACTGCTGGTCGCCGTATTCCTCGACCAGATATTTGCG
CGCAAGGACTTTACTAGTTTTGGCCTCTCCAGCAATGTGCCGCCGGGCTTCCAGGAGCACCAAGCCTATCTCAAG
TCATACATACTCAGGAGGGTGATTGCTCGCGTGTCGGACCACATTCATGGCAACAGAAAGACCATCTGCGAGCCT
CGCATTCTGACCAACTTGTCGCGGCTCTGCTTGCACATATCGGAAGCCATCTTCGAGGGCTGGTTCATGGACGGG
GCGGAGGTGATGATTGATTTTAACGGCATGTTGCTGGAGCAGCTTCAGCGGCCCGACATCTGCAAGATGAAGAGC
GTACGACTGTGCAGTCAGGCCGTCACCGTGATTCGTAACTGCTTCCTCAGGATCGTCCTGCTGAGGCTCTCGGAC
CTGGACGACGATCGGGTCACGGAGAGGGAGGCCAAGGACTTTATGAACAAGCTCGCCTACTGGCAAATGTCTATA
CTCGAGTGCTTCAACGTGGACGATGAGTACCTGAGGCTGTTTTGGTATCAGCTCTACACGAAGCTCATCGACGAC
AAATGGTCCGTACGCATCGCCGCGGCCAACTTTCTGCGCATCGTCCAGGTGCAGAAGCCCGAGGAGTCGGTTGCC
ATAGTGCGTTCGTGCATGACGCCGGACCAGAAGAAGCTGTCGAGAGAATTCCAGAAGCTCACCGAGGTGGACGAC
GAGACGTTTGTCGCCTGGGTGGATCAGCACCGGCCATCGCTGGATCAGCTTTTCCTCGGGAACATGGCGAAGACG
TGGGAGGACTTCGTCAGCTCGGAGTACCACAAGTCCCTCGAAACCGCCAAAAGTCGCGTGTCTAAGCGCAAGGAG
AGGCTTCAGGCGTGGCATGTGGAGGCCATCAGCACGGACAAGATTCTTCTCAGCCATGCGGTGGGCAACAGCGCG
TGGATGAAGAGCATCTACAACACGGAGCATTTCAAGTACCAGCGTCTTTTGCAAGACCAGCAGGATGACTTGTCC
TTCCTCATGGCCGGCTACAGCAAGATGGAGAGGGACCTCAGGAGACCGGGCGCGGTATTCAGCGAGCCGGCCTCG
ACCAAGTGGAAGCTGGACCGGACCGAGGGGCGCAACCGGATGCGGCTGAGGCTGCTGCCGGATTCGCCCGCGACC
GAAGAGAAATACCGGCCGAAGAGAAAAGGGGCTGAAGCGCGGGCCCAGACACCGATCAACACGCCGGCTTCGAAC
GGCCGTCACGAGGCGCGGCCGCCGTCGACCAACTTGGAACTTGATGTCAACGACGAGACGACGACTGTCAACGCC
GAGGGCGCGACAAGAACGGAAACAACGGAGACGGGATGCGCTCCTGAAGACGACTTTGAGCTCGTTCAAGACCCC
AATGATCCTGTCGAGGGCGACGAGAACTTCGAAGATAAGAACCGCAAGGTGATGCGGCGGCTCGAGCAGGGCGAG
CAAGTACAGGCTGCCTATAACATGTCTCGCATCACCGGCCTCGAGGCTTGCGAGGGCCTTCTCATCGTGGGAAAG
GACGCGCTGTACATCATGGACAACGTGTTCCAATGCGCGAGCGGAGAAATCGTCGATGTGTGGCAGGCCCCGGCT
GAGGAACGAGACCCCTTCAGCATGGTCGTGACGGGGGCCAAGACGCTGGAGAAACGGCAGAACTCGGGAGCCAGG
GATCAAGAATCGAGGCACTGGCGCTGGCACGACGTTATCAGCGTTTCCAAGCGTCGTTTTCTCTTTCGAGACGTT
GCCATCGAGGTCTTCTTCACAGACGGGCGTAGCTATCTCCTGACGACCATCAATCCGGCCATCAGAGACGAGCTG
TTCGCCAAGATGCTCGCCAAGGCGGGACCCAACGCGGTCCCGAACCCGGAGGATGGCTGGCGGCTGGGGGCGCTG
AAGACGGCGGAGAACGAGCTGCCTCAGGGGTTCGGGGCGGGCCTGGGCTCCAAGCTCGGCACGCTGTTCAACGCG
GCGCCGTGGAACCCGGCGATGCGGCGGTGGCAGCGGGGAGAGCTGTCCAACTTTCACTACCTCATGATGGTCAAC
ACCATGGCTGGGCGGACATTCAACGACCTGACGCAGTACCCGGTCTTCCCCTGGATTCTGGCCGACTACAGCAGC
GAGGAGCTAGACCTGGATGATCCGGTCACGTTCCGCGATCTCTCGAAGCCAATGGGCGGCCAAACGCAGGGCCGG
GTGGCGGGTTTCGTCGAGACATACAAGGCACTGCAAGAAATTGACCAGACGCCGTTTCACTATGGCACGCACTAC
TCGTCGGCCATGATCGTGTCGTCATACCTGATCCGGCTGCCGCCGTTTGTGCAGTCATATCTGCTGGTTCAGGGT
GACAGCTTCGACCACGCCGACCGTCTATTTCAGTCCATAGGGGACGCGTGGGAGTCGGCGTCGTGTCGGAACAAG
ACGGACGTCCGGGAGCTGATCCCCGAGTTCTTTTGTTTGCCCGAGTTCCTGACCAACATCAACGGCTACGACTTT
GGCCACCGTCAGAGCAACGGCGTCAAGGTGGACAATGTGGCGCTACCGCCGTGGGCCAAGGGGGACCCCAAGATC
TTCATTGCACGGCACCGCGAGGCTCTCGAGAGCCGGTATGTCAGCGAGAATCTACATCACTGGATCGACCTCGTC
TTCGGCTGCAAACAGCGGGGCGAGGCGGCTGTGGAGAGCCTCAACGTCTTCCACCACCTGTCGTATGCGGGCGCC
AGCGACCTGGACCGCATTACAGACGCCAACGAGAGGGCCATCACGGCGGGCGTCATTCACAACTTTGGGCAGACG
CCGCATCAGGTGTTTAGCAAACCGCACCCGGCGAGGGAGAATATGCGCTGTCCGACCAGGAGGCTTGATACGGCC
GTGTTTTCGTTGAGCCGGTCGGATCATCCGATGCTGGAGAGCCACGAGCGAGTGGCATCACTGGTCTATGTGACC
AAGTCGGATCGATTACTATGCGCTTCGCCGCTTCGCCTCAATCTTCCCCCCTATGACAAGTTTCTCGAATGGGGC
TACGCCGACGGCAGCGTCCGCTTCTTCTTTAGCGACAACCGCAAGCCGGCCGGGCTCTTCGAGAACCTACACATT
GGACAAATCTCATGTGCCTGTTTTGCCGACTCCAAGACGCTCATCACGGCGGGCGAGGACTGCGTCGTCTCGGTC
TACTCGGTGCTCACGGCGCCAGGGAAGCAGGTAGAGCTCGTCCCGCGGTCGAGCGTCTTCGGCCACAAGACGCCC
GTGACGGCCATGGCAGTAAGCAAGGCTGTGAGCACATTTGTGACGGCCTCTTCGGACGGGCAGGCCTTTTTATGG
GATCTCAACCGGTTGTCGTTTATACGCAAGCTGCCGTTGGTGCGACAGGTCGAGTGCGCGCGCATCAACGACGTC
TCGGGTGACATAATGCTCTGCTCAGGACCAAACGTGGTGCTGTACACGCTCAACGGTTCGCTGCTCCTGGAGCAA
AAGGTGTGCGAAGGGGATGACTACGTGCACTCGTGTGCCTTTTACGAGGGCGCGGGCGACGAGTGGCTCGAGGAC
CAGCTGGTCTTTACAGGCCATGGCGGCGGACGCGTCAAAGTTTGGCGCAAGTGCTGGACCACGGATGGCCGATGG
ACGCTCGAGCTGCTGCGGCAGTTGGACCACGGTGGGGGAGAGAAGGCGGCGGGCATCACCTGCATCACGCCGATG
CCAAGTTGTCTTTACACGGGGGATGACGACGGCCGAGTGTTTGAATGGGGCCTCGGACGCGGCGAGAGATAG
Gene >Ophio5|1620
ATGGCCTTTCATCCTCGACGCCGGCGGGCTTCAACCTCGGTCTCGTTGCAGCCGACGTCCGATTCTTTCCAGCTG
CTGTGCGGTCTGCTCGACAGCCTGGTTGACGACGCCGCCTCGTTGGGAGCCGACGGATATCCCCAAGTCGACAGC
CTCGTCGGGCACCTTAGGCTCGTTTCTCGCCATGTCGTCACTTCTTCGTCGCCTGCAGTTGCGGACGACTTTCGA
CACGCTCACGGCTTCGAGTCTGTTCTCGGCGCTCTTCGCCATTTCTCGGGCTACTATGACCCCCGCAAGAGAGAC
GAATCCGAGATGCTCTCCCTCTTTACCTTGCTCGGCGCCTGTCTCGATCTCCTTTCGGCCGCGCTGAGGGACAAC
TCGACCAACAGGCGGTTTTTTCGCCATCGTGTCGAGGGTGGCGGATGGGAGGCTCTTGAGCAGGTCATAGCGAGC
ATTGGCCTCGGCGGCGCTGAGCTGGATCCTTGGGTCAGCTGCAACGCCTTTGGCAAACTTCTCTCCTTTTCACTG
GAGGACGAAGGTCTCGATCTTCTCTGCCAGTCCGTCGCCCAGGCGCTGCGGCCCGAGGCTTCTGGCACTTTGAGC
CGCTCCGAAGATGACGAGCAGTGGGAGCTCATCCTGGCCCGCTCCGTCGAGAACATTGGCCCCGCGGTGCGGGAG
GTGGTTACTCCCGGGACCATAGTCCGCTTTCCGGAGATCCTCAGAGCAGTCGTGAGCTTCTGGACGGCCATACCG
CGACCGCATGGCTCGTCGGCAAGTCCCAGCTCCGTCCTCGTGCTCGAGACGATGCTGCGAATAGTCTCCGTCTCC
TTTTACAACCGCGCCGCCGTTCACTCCACCGGAGTCTTGTCCCAACTGCTACGTGTGGCCTTTGGAAAAGGCACG
TGGCTCGCCGAGCCCGAACGCGAGAGGCTGTTGGCCGTATGCCGGCTGCTCATGGCTCTTGGCGTGAATCAGCCG
GCTGATACGCAGTTTCTCCTCTCTGCCCCCGGAGCCGAAGCCTCCGACTTTTGTCTCGAGATGATGTCCGAACAC
ACGGGCCCGCCCTTCTTCCAGTTCGACCTGTCACTCCACGGATACTCGTCTCTCGAGCTGCCGAGCCTCGGCCGC
GCATTTCCCCCGCAGTCGAGTGCCGGCTACACCTTCGCCGCCTGGATCCGCGTTGACACGTTCGATCCGTCCGCC
CACACAACCATCTTTGGCCTCTACGACTCCTCGCAGACCTGTTTTTTGCTGCTGTATCTGGAACGAGACACTCAA
AACCTCATCCTCCAAACCTCGGTTCATTCCAGCAAGCCAAGTGTGAGGCTCAAGTCAGTCGTGTTCCGCGAGCAG
AAGTGGTATCACGTCGCCGTCGTTCATAAGAGGCCCAAGACTATGGTCGCCAGCAAGGCGCTGCTGTACGTCAAT
GGGGATTTCGCCGAGCAGGTCCGCTGCAGCTACCCTCGCTCGCCGCCGCTCTCGAATGGCAGCGTCGAGAGCTTC
GCGACCTTAAACCCAAGCCAGAGCAGGACAAATCCCGTCCAGGCCTTCCTCGGCACGCCTCGCGACTTGGCTGGC
CGCACGGGACCGGGTGTTGTCGTCTCCAAGTGGTCGCTTGCCTCGGCCCATCTCTTCGAGGAGGTCATGAGCGAT
GATTACCTGGCCGTCCACTACGGCCTGGGTCCTCGATACCAGGGCAACTTTCAGGATAGTCTCGGAGGCTTTCAG
ACGTACGAGGCGTCCGCCACCTTGGGTCTCCGCAACGAGCTGGTACACCCGGGCAAGGATGAGAACTCGGACATT
CTTCGAGCTGTGCGCGACAAGGCAAGCTCCCTACTGCCAGAATCCAAGATACTTCTCAGCGCCCTCCCCACCGGA
ACCTTTCCCGAGCACGTGCAGTTTCTCGATACCGGCGTTTTGCGCTCGCTGCCTCGCGTGTCTGTACGCAATCTC
GTCCACATGTCCAACCAAGAGGGCGCCCCATTGGCCGTGAATTGTGCCGTCTCTAGCCTGTCAGATGCCCTCATG
AGGACCAATGGAATCGCTTCCCTTTGCGGGACTCCCATCGTTGCCCTGCCGTCGCACCTGGATGAGAATCTCTGG
CGTCTCGCCGGCTTCACGCCGCTGGCTCTCAAGCTGCTTGAGAGGGCTTCGACGGCGGAGGAGCTTATTCGCGCA
GTTGAAATAATGTTTCACTGCATACGCAGGAGTTGGCGTAACAGTGAAGCCATGGAAAGAGACAATGGATACGGC
ATCCTGGGCATGATCCTCCGCTTCAAAATTGGGTACGGCAACTACGCTTCGGGAGACGCGCCGATTTCTCGTCTC
TCGATATCAAACGAGGACCGCGATAGCCTGGCGTTTCGGGTGCTGAGTCTCATCCTCGACTTTGTCGGCTACAAC
CACATGGAGCCCATCGAGTCCTTCATTGTCAACCCCCTCGCTTACCGGATACTCCTCATCGACTTGGACATCTGG
AGACGATCCGCCAACCGCACCCAGGAGCTCTTTTACAAGCAGTTTGTGACATTTGCCGTTAACAGCAAGCACCAC
GAGTTCAACAGCAGGAGGTTGGTACGCATGCGTAAGTCGCTGCCTTTTCCTCTCGCGGTGCGTTAGCTGACGGCC
CGTCTGTTCTAGGGGTCGTGAAGAGGTTGCTCGACTCCACAAAGGGGGAGGGGGTATCCGAAGAAGTTGTCGACC
ACTTCATGAATGCCTTTGAAGCACTTGTCAAATCCAATCTCAGCCAGGAAGTCATGAGGTTCATGTCCTTGTTCA
TCACCTACGCCTTTCACACCTGCCCGCCTTCGGCATCGCGGACGCCAAAAGCGTCCTCCACGTCACACTTGAGCA
TCTCAGGCCTCGCTAGGCGGCTGACCGGGGATGTCAACAGGACGCGCAGTCCTTCGGCGGTCGGAACTAGGGTGC
TGTCTAAGAAGCAGCTCGGAATCCGTGTGCTGGCCATGTATGCCGGAATTTTGTGCGAAAAGGGCAGCTTCAATA
ACATCAAGAAATTCGCCAGAACCGTCACCAACAAGGTGAGAGTGGCCACAGGTTCGTGATAATGGATAAGGTTGT
TAATCTTCGCAGTGGCTCCTCTACCTGCTGGCGGATGACGACGCCGCGGTGGTCCTCCATGGGTCCATGATCCTC
TCTAGGCTGCTCGTCGCCCATGGATCTTCGTACACGTCCAAGTTCACGGGAAAGTCTGGCGGTTTCACCATCATG
GCGACTCGGCTCAAGAGGTTCTGGGACATTCCCACGCTTTGGACGATATGCTTTAGCATCTTGTTTGGGTACGAC
ATTGCTGAGCTTGACCTTGATCGTGACTTTGATGTAGACAACCTGCTCGGCATGTTTGTCAAGCGGAAGGTGGTC
CATCCCGAAAGCCTGGTTGTCATCACATCGTTGCTCCAGCACGGTATCAAGGAGGTCATGAGGTATCAGGAGGAT
CCAGACTCGCCGGCCAAGGTGGATGGCTCGCCTGCTGCAAGGAGGGCCAGGCCGAAGCCCGAGACTGGGCCTCGA
GTCCTGTCCATGAACCCGACCAAGGCACTCGAAGCTCGAAGTGAGTGTATTCACCTTCCGGACTGGGACGCCTCT
GATGCTTTTACAGCGAGTCTGCATTACCCCCTCGATAGGGTCACCGGGCGTGTCGACATATTGCAGACGTCGATC
GGGTTCCTACAAGAGCTTCACGCTCGGTCGTCCAGCTTCCGAGACTTTTCCTTGTCATCCGAATGGGTTCGCACG
CTGCTTTTGGCTCTCTATCCCGCCATCGTCGGCTCGGATGCGGTTACGCCGGAAGCTGAGCTGAATTCACGGGAT
TCCGTGCTCACATTTGAGGGCAGCGACGTCATCATCAGGCCTATAGCAGGCGTTCAGGCAGCCGCTCCGATCGTA
CGCACGAGCCACGTCCATGTGATGCCATCGCCGCAAGCAACACCTCCCAAGGGCACCCCTCTCCGCCGGGCATCT
TCCTTTGTCCTCCTGACGGCGCAGACGGCATCTCGCGTTGACGACGGCCTCTCCGCTCCCTCGCCGCAGACTCAG
GCTCGACAGAGCAGCGGCGGTATTCTGTCCGAGGGGATGCTAGAACTGCTGGTCGCCGTATTCCTCGACCAGATA
TTTGCGCGCAAGGACTTTACTAGTTTTGGCCTCTCCAGCAATGTGCCGCCGGGCTTCCAGGAGCACCAAGCCTAT
CTCAAGTCATACATACTCAGGAGGGTGATTGCTCGCGTGTCGGACCACATTCATGGCAACAGAAAGACCATCTGC
GAGCCTCGCATTCTGACCAACTTGTCGCGGCTCTGCTTGCACATATCGGAAGCCATCTTCGAGGGCTGGTTCATG
GACGGGGCGGAGGTGATGATTGATTTTAACGGCATGTTGCTGGAGCAGCTTCAGCGGCCCGACATCTGCAAGATG
AAGAGCGTACGACTGTGCAGTCAGGCCGTCACCGTGATTCGTAACTGCTTCCTCAGGATCGTCCTGCTGAGGCTC
TCGGACCTGGACGACGATCGGGTCACGGAGAGGGAGGCCAAGGACTTTATGAACAAGCTCGCCTACTGGCAAATG
TCTATACTCGAGTGCTTCAACGTGGACGATGAGTACCTGAGGCTGTTTTGGTATCAGCTCTACACGAAGCTCATC
GACGACAAATGGTCCGTACGCATCGCCGCGGCCAACTTTCTGCGCATCGTCCAGGTGCAGAAGCCCGAGGAGTCG
GTTGCCATAGTGCGTTCGTGCATGACGCCGGACCAGAAGAAGCTGTCGAGAGAATTCCAGAAGCTCACCGAGGTG
GACGACGAGACGTTTGTCGCCTGGGTGGATCAGCACCGGCCATCGCTGGATCAGCTTTTCCTCGGGAACATGGCG
AAGACGTGGGAGGACTTCGTCAGCTCGGAGTACCACAAGTCCCTCGAAACCGCCAAAAGTCGCGTGTCTAAGCGC
AAGGAGAGGCTTCAGGCGTGGCATGTGGAGGCCATCAGCACGGACAAGATTCTTCTCAGCCATGCGGTGGGCAAC
AGCGCGTGGATGAAGAGCATCTACAACACGGAGCATTTCAAGTACCAGCGTCTTTTGCAAGACCAGCAGGATGAC
TTGTCCTTCCTCATGGCCGGCTACAGCAAGATGGAGAGGGACCTCAGGAGACCGGGCGCGGTATTCAGCGAGCCG
GCCTCGACCAAGTGGAAGCTGGACCGGACCGAGGGGCGCAACCGGATGCGGCTGAGGCTGCTGCCGGATTCGCCC
GCGACCGAAGAGAAATACCGGCCGAAGAGAAAAGGGGCTGAAGCGCGGGCCCAGACACCGATCAACACGCCGGCT
TCGAACGGCCGTCACGAGGCGCGGCCGCCGTCGACCAACTTGGAACTTGATGTCAACGACGAGACGACGACTGTC
AACGCCGAGGGCGCGACAAGAACGGAAACAACGGAGACGGGATGCGCTCCTGAAGACGACTTTGAGCTCGTTCAA
GACCCCAATGATCCTGTCGAGGGCGACGAGAACTTCGAAGATAAGAACCGCAAGGTGATGCGGCGGCTCGAGCAG
GGCGAGCAAGTACAGGCTGCCTATAACATGTCTCGCATCACCGGCCTCGAGGCTTGCGAGGGCCTTCTCATCGTG
GGAAAGGACGCGCTGTACATCATGGACAACGTGTTCCAATGCGCGAGCGGAGAAATCGTCGATGTGTGGCAGGCC
CCGGCTGAGGAACGAGACCCCTTCAGCATGGTCGTGACGGGGGCCAAGACGCTGGAGAAACGGCAGAACTCGGGA
GCCAGGGATCAAGAATCGAGGCACTGGCGCTGGCACGACGTTATCAGCGTTTCCAAGCGTCGTTTTCTCTTTCGA
GACGTTGCCATCGAGGTCTTCTTCACAGACGGGCGTAGCTATCTCCTGACGACCATCAATCCGGCCATCAGAGAC
GAGCTGTTCGCCAAGATGCTCGCCAAGGCGGGACCCAACGCGGTCCCGAACCCGGAGGATGGCTGGCGGCTGGGG
GCGCTGAAGACGGCGGAGAACGAGCTGCCTCAGGGGTTCGGGGCGGGCCTGGGCTCCAAGCTCGGCACGCTGTTC
AACGCGGCGCCGTGGAACCCGGCGATGCGGCGGTGGCAGCGGGGAGAGCTGTCCAACTTTCACTACCTCATGATG
GTCAACACCATGGCTGGGCGGACATTCAACGACCTGACGCAGTACCCGGTCTTCCCCTGGATTCTGGCCGACTAC
AGCAGCGAGGAGCTAGACCTGGATGATCCGGTCACGTTCCGCGATCTCTCGAAGCCAATGGGCGGCCAAACGCAG
GGCCGGGTGGCGGGTTTCGTCGAGACATACAAGGCACTGCAAGAAATTGACCAGACGCCGTTTCACTATGGCACG
CACTACTCGTCGGCCATGATCGTGTCGTCATACCTGATCCGGCTGCCGCCGTTTGTGCAGTCATATCTGCTGGTT
CAGGGTGACAGCTTCGACCACGCCGACCGTCTATTTCAGTCCATAGGGGACGCGTGGGAGTCGGCGTCGTGTCGG
AACAAGACGGACGTCCGGGAGCTGATCCCCGAGTTCTTTTGTTTGCCCGAGTTCCTGACCAACATCAACGGCTAC
GACTTTGGCCACCGTCAGAGCAACGGCGTCAAGGTGGACAATGTGGCGCTACCGCCGTGGGCCAAGGGGGACCCC
AAGATCTTCATTGCACGGCACCGCGAGGCTCTCGAGAGCCGGTATGTCAGCGAGAATCTACATCACTGGATCGAC
CTCGTCTTCGGCTGCAAACAGCGGGGCGAGGCGGCTGTGGAGAGCCTCAACGTCTTCCACCACCTGTCGTATGCG
GGCGCCAGCGACCTGGACCGCATTACAGACGCCAACGAGAGGGCCATCACGGCGGGCGTCATTCACAACTTTGGG
CAGACGCCGCATCAGGTGTTTAGCAAACCGCACCCGGCGAGGGAGAATATGCGCTGTCCGACCAGGAGGCTTGAT
ACGGCCGTGTTTTCGTTGAGCCGGTCGGATCATCCGATGCTGGGTAAGGAAGGGTCAGGGGGGTCAAGCTGCGAG
GGCTACGGGCTGGCTGACGATGAATAGAGAGCCACGAGCGAGTGGCATCACTGGTCTATGTGACCAAGTCGGATC
GATTACTATGCGCTTCGCCGCTTCGCCTCAATCTTCCCCCCTATGACAAGTTTCTCGAATGGGGCTACGCCGACG
GCAGCGTCCGCTTCTTCTTTAGCGACAACCGCAAGGTGAGTGTCAGAGTCAGACCTGGTTTGACGCAGCCGAGCT
GACGGAGGCACTCATCAGCCGGCCGGGCTCTTCGAGAACCTACACATTGGACAAATCTCATGTGCCTGTTTTGCC
GACTCCAAGACGCTCATCACGGCGGGCGAGGACTGCGTCGTCTCGGTCTACTCGGTGCTCACGGCGCCAGGGAAG
CAGGTAGAGCTCGTCCCGCGGTCGAGCGTCTTCGGCCACAAGACGCCCGTGACGGCCATGGCAGTAAGCAAGGCT
GTGAGCACATTTGTGACGGCCTCTTCGGACGGGCAGGCCTTTTTATGGGATCTCAACCGGTTGTCGTTTATACGC
AAGCTGCCGTTGGTGCGACAGGTCGAGTGCGCGCGCATCAACGACGTCTCGGGTGACATAATGCTCTGCTCAGGA
CCAAACGTGGTGCTGTACACGCTCAACGGTTCGCTGCTCCTGGAGCAAAAGGTGTGCGAAGGGGATGACTACGTG
CACTCGTGTGCCTTTTACGAGGGCGCGGGCGACGAGTGGCTCGAGGACCAGCTGGTCTTTACAGGCCATGGCGGC
GGACGCGTCAAAGTTTGGCGCAAGTGCTGGACCACGGATGGCCGATGGACGCTCGAGCTGCTGCGGCAGTTGGAC
CACGGTGGGGGAGAGAAGGCGGCGGGCATCACCTGCATCACGCCGATGCCAAGTTGTCTTTACACGGGGGATGAC
GACGGCCGAGTGGTGAGTTCTGAGGTGGGTCAAGGGAGAAGATGACGCTGACGTTGTTGACTATAGTTTGAATGG
GGCCTCGGACGCGGCGAGAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail