Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|162
Gene name
Locationscaffold_102:4922..6031
Strand-
Gene length (bp)1109
Transcript length (bp)864
Coding sequence length (bp)861
Protein length (aa) 287

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08611 DUF1774 Fungal protein of unknown function (DUF1774) 1.5E-37 191 285

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 74 96 22
3 103 125 22
4 130 149 19
5 156 178 22
6 188 210 22
7 215 232 17
8 242 264 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|162
MTNWEHYNPFSKRESHSAGSILTYKILTLVTWILSVVVSVYYTVHQPHDGFNIRNRIWDQNYLYPSAFTMNHVLA
EIYWVVLFILQFGYITHLFSSKTENVYAAAGVGSHFIVNNLLHFAFVMLFVRSHFHWAELVLVINFINLSSLYFR
HNSYARFIHAPAVSGPLAWTFVAIYWNGALMVPHQHNLVARVFGNIFIWSLLGYGSFFILAYKDYTMGFALSVLA
AAIGVAQFERQVVALQWIFAFVIMALLFVMTIVIALPTWAGRDLKWRRTSQTDQERAPLLED
Coding >Ophio5|162
ATGACGAATTGGGAGCACTACAACCCCTTCAGCAAGCGTGAATCGCATAGCGCTGGCTCCATCCTCACCTACAAG
ATACTCACGCTCGTCACCTGGATCCTGTCCGTTGTCGTGTCTGTTTACTATACCGTTCATCAGCCGCATGATGGC
TTCAATATCCGAAACCGCATCTGGGATCAGAATTATCTCTACCCGAGCGCCTTTACCATGAATCATGTCCTCGCC
GAGATTTACTGGGTTGTCCTCTTCATCTTGCAGTTTGGTTACATCACCCATCTCTTCTCTAGCAAGACGGAAAAC
GTCTACGCCGCCGCCGGTGTGGGCAGCCACTTCATCGTCAATAACCTCTTGCACTTTGCCTTTGTCATGCTCTTT
GTCCGCTCGCATTTCCACTGGGCCGAGTTGGTTCTCGTCATCAACTTTATCAACCTCAGCTCTCTCTACTTCCGC
CATAACTCCTATGCTCGCTTCATCCACGCGCCGGCCGTGTCCGGGCCTCTCGCCTGGACCTTTGTCGCCATTTAC
TGGAACGGGGCGCTGATGGTCCCTCATCAGCACAATCTGGTCGCTCGCGTCTTTGGCAACATCTTCATCTGGTCT
CTTCTCGGCTACGGTTCCTTCTTCATCCTGGCCTACAAGGACTACACCATGGGCTTCGCCCTCAGCGTCCTCGCA
GCTGCCATTGGCGTGGCCCAGTTCGAGCGTCAGGTCGTCGCCCTACAGTGGATCTTTGCCTTTGTCATCATGGCC
CTGCTCTTCGTCATGACTATCGTCATCGCCCTGCCGACTTGGGCCGGACGGGATCTCAAGTGGAGGCGCACCAGC
CAGACGGACCAGGAACGCGCTCCTCTGCTCGAGGAT
Transcript >Ophio5|162
ATGACGAATTGGGAGCACTACAACCCCTTCAGCAAGCGTGAATCGCATAGCGCTGGCTCCATCCTCACCTACAAG
ATACTCACGCTCGTCACCTGGATCCTGTCCGTTGTCGTGTCTGTTTACTATACCGTTCATCAGCCGCATGATGGC
TTCAATATCCGAAACCGCATCTGGGATCAGAATTATCTCTACCCGAGCGCCTTTACCATGAATCATGTCCTCGCC
GAGATTTACTGGGTTGTCCTCTTCATCTTGCAGTTTGGTTACATCACCCATCTCTTCTCTAGCAAGACGGAAAAC
GTCTACGCCGCCGCCGGTGTGGGCAGCCACTTCATCGTCAATAACCTCTTGCACTTTGCCTTTGTCATGCTCTTT
GTCCGCTCGCATTTCCACTGGGCCGAGTTGGTTCTCGTCATCAACTTTATCAACCTCAGCTCTCTCTACTTCCGC
CATAACTCCTATGCTCGCTTCATCCACGCGCCGGCCGTGTCCGGGCCTCTCGCCTGGACCTTTGTCGCCATTTAC
TGGAACGGGGCGCTGATGGTCCCTCATCAGCACAATCTGGTCGCTCGCGTCTTTGGCAACATCTTCATCTGGTCT
CTTCTCGGCTACGGTTCCTTCTTCATCCTGGCCTACAAGGACTACACCATGGGCTTCGCCCTCAGCGTCCTCGCA
GCTGCCATTGGCGTGGCCCAGTTCGAGCGTCAGGTCGTCGCCCTACAGTGGATCTTTGCCTTTGTCATCATGGCC
CTGCTCTTCGTCATGACTATCGTCATCGCCCTGCCGACTTGGGCCGGACGGGATCTCAAGTGGAGGCGCACCAGC
CAGACGGACCAGGAACGCGCTCCTCTGCTCGAGGATTAA
Gene >Ophio5|162
ATGACGAATTGGGAGCACTGTTGGTTCATCGAATTCAGTCATCCGTCGCCGTCTAGGCTAACCGTTTTGTTTCCC
CCCATTCTTCTTCCTTTTCTTCTTCTGCAGACAACCCCTTCAGCAAGCGTGAATCGCATAGCGCTGGCTCCATCC
TCACCTACAAGATACTCACGCTCGTCACCTGGATCCTGTCCGTTGTCGTGTCTGTTTACTATACCGTTCATCAGC
CGCATGATGGCTTCAATATCCGAAACCGCATCTGGGATCAGAATTATCTCTACCCGAGCGCCTTTACCATGAATC
ATGTCCTCGCCGAGATTTACTGGTGCGTTTTTTGCCTTCTTCTTTTGTTCAAAAAAAACAACATGCCGCCCTGTC
TGGGCTCCTGACTGACAAGAGGAGCTGACCGAACGATAGGGTTGTCCTCTTCATCTTGCAGTTTGGTTACATCAC
CCATCTCTTCTCTAGCAAGACGGAAAACGTCTACGCCGCCGCCGGTGTGGGCAGCCACTTCATCGTCAATAACCT
CTTGCACTTTGCCTTTGTCATGCTCTTTGTCCGCTCGCATTTCCACTGGGCCGAGTTGGTTCTCGTCATCAACTT
TATCAACCTCAGCTCTCTCTACTTCCGCCATAACTCCTATGCTCGCTTCATCCACGCGCCGGCCGTGTCCGGGCC
TCTCGCCTGGACCTTTGTCGCCATTTACTGGAACGGGGCGCTGATGGTCCCTCATCAGCACAATCTGGTCGCTCG
CGTCTTTGGCAACATCTTCATCTGGTCTCTTCTCGGCTACGGTTCCTTCTTCATCCTGGCCTACAAGGTGAGTCG
ACTCTGTGACGAGTCTTACCATTTGCGTGGCGGCCAGCTTACTAGCCATTCATCTACAGGACTACACCATGGGCT
TCGCCCTCAGCGTCCTCGCAGCTGCCATTGGCGTGGCCCAGTTCGAGCGTCAGGTCGTCGCCCTACAGTGGATCT
TTGCCTTTGTCATCATGGCCCTGCTCTTCGTCATGACTATCGTCATCGCCCTGCCGACTTGGGCCGGACGGGATC
TCAAGTGGAGGCGCACCAGCCAGACGGACCAGGAACGCGCTCCTCTGCTCGAGGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail