Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1619
Gene name
Locationscaffold_16:2116..2615
Strand+
Gene length (bp)499
Transcript length (bp)402
Coding sequence length (bp)399
Protein length (aa) 133

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P42117|NDUA3_NEUCR NADH-ubiquinone oxidoreductase 9.5 kDa subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo9.5 PE=1 SV=3 42 117 1.0E-24

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 64 83 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 153.28 75.14 231.42
CcL In ants, during behavior modification 101.97 44.90 159.05
CcD In ants, recently dead 283.76 154.47 413.06

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.125410 no
SC16a CcD 0.008585 yes
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1619
MGSFIRATTIAPTSLAFGSSPHHHRTHFTERKPEQLKLLAMSSAPYFWSAPIGYCRWALRERPAIFWSIVIGAAG
PIAMPIVPPLRRYFGDVDAPQVPVTYPVPPGPRKVLSGFDDEEPVLSVRRPSKPAAEQ
Coding >Ophio5|1619
ATGGGGAGCTTCATACGAGCCACCACCATAGCTCCGACGTCTCTCGCCTTCGGGAGCTCACCGCATCACCACCGC
ACTCATTTCACCGAGAGAAAGCCTGAACAGCTAAAACTCCTCGCCATGTCCTCGGCACCCTACTTCTGGTCCGCG
CCCATCGGATACTGCCGCTGGGCCTTACGCGAGCGCCCCGCCATCTTCTGGTCCATCGTCATCGGCGCCGCTGGT
CCCATTGCCATGCCAATTGTGCCTCCTCTGCGCCGCTACTTTGGCGACGTCGATGCGCCGCAGGTTCCCGTCACC
TATCCCGTTCCTCCCGGTCCGCGCAAGGTCCTGTCCGGCTTCGACGATGAAGAGCCGGTCTTGTCTGTCCGTCGC
CCGTCAAAACCCGCCGCTGAACAA
Transcript >Ophio5|1619
ATGGGGAGCTTCATACGAGCCACCACCATAGCTCCGACGTCTCTCGCCTTCGGGAGCTCACCGCATCACCACCGC
ACTCATTTCACCGAGAGAAAGCCTGAACAGCTAAAACTCCTCGCCATGTCCTCGGCACCCTACTTCTGGTCCGCG
CCCATCGGATACTGCCGCTGGGCCTTACGCGAGCGCCCCGCCATCTTCTGGTCCATCGTCATCGGCGCCGCTGGT
CCCATTGCCATGCCAATTGTGCCTCCTCTGCGCCGCTACTTTGGCGACGTCGATGCGCCGCAGGTTCCCGTCACC
TATCCCGTTCCTCCCGGTCCGCGCAAGGTCCTGTCCGGCTTCGACGATGAAGAGCCGGTCTTGTCTGTCCGTCGC
CCGTCAAAACCCGCCGCTGAACAATGA
Gene >Ophio5|1619
ATGGGGAGCTTCATACGAGCCACCACCATAGCTCCGACGTCTCTCGCCTTCGGGAGCTCACCGCATCACCACCGC
ACTCATTTCACCGAGAGAAAGCCTGAACAGCTAAAACTCCTCGCCATGTCCTCGGCACCCTACTTCTGGTCCGCG
CCCATCGGATACTGCCGCTGGGCCTTACGCGAGCGCCCCGCCATCTTCTGGTCCATCGTCATCGGCGCCGCTGGT
CCCATTGCCATGCCAATTGTGCCTCCTCTGCGCCGCTACTTTGGCGACGTCGATGCGCCGCAGGTTCCCGTCACC
TATCCCGGTAATGCCCAGGCTTCCTCTGGCCTTTTCCCGTCTTTGACATCGTCGCTTGACCACTGCTTCCCTCGT
CCCGTCCTGCTGATGCCACTTTTCTCCAGTTCCTCCCGGTCCGCGCAAGGTCCTGTCCGGCTTCGACGATGAAGA
GCCGGTCTTGTCTGTCCGTCGCCCGTCAAAACCCGCCGCTGAACAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail