Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1611
Gene name
Locationscaffold_159:25254..26332
Strand+
Gene length (bp)1078
Transcript length (bp)960
Coding sequence length (bp)957
Protein length (aa) 319

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family 1.7E-17 72 259
PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase 1.1E-06 71 264

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.1086 0.0599 0.8378 0.3691 0.0893 0.0344 0.2364 0.2158 0.2127 0.0132

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999693

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
CE3 2.6E-40 68 267

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 87.51 47.95 127.07
CcL In ants, during behavior modification 214.33 110.35 318.31
CcD In ants, recently dead 195.99 104.00 287.99

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.746185 no

Orthologs

Orthofinder run ID4
Orthogroup547
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4177
Ophiocordyceps australis map64 (Brazil) OphauB2|6260
Ophiocordyceps camponoti-floridani Ophcf2|04329
Ophiocordyceps camponoti-rufipedis Ophun1|3726
Ophiocordyceps kimflemingae Ophio5|1611 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3955
Ophiocordyceps subramaniannii Hirsu2|5674

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1611
MRAPLLAVACCLLRLTVAAAVGLEVALERDLAPRLVARTNTSSSSVLNPRQNLTAPGNGRGIQSGPQLRLLCAGD
SITAGTFSETDGGDGNGYRLRLRDDLSADRVVFAGTETAPNGTMNDGFFAAWPGKTIKFITDNIGPSLQQRPNVI
LLHAGTNDMNPDPAISTEGNNPAEAVKRLGVLVDRMVETCPDAVVLVAMIINTCNETQAPATQEFQRQIPDMVRQ
RFEDGRRVLAANITSFPSDQLRDCIHPNNDGYRLLGDYWSDFVRQVPEDWLHDPEEANNAGEPSASASMRLAPLP
SMWPMTVAAAIVAGSIVGW
Coding >Ophio5|1611
ATGCGGGCTCCTCTGCTGGCGGTCGCCTGCTGCCTGCTCAGGCTTACCGTCGCCGCCGCGGTTGGCCTAGAAGTC
GCGCTTGAGAGAGATCTGGCCCCGAGGCTGGTGGCAAGGACCAACACTTCTTCCAGCTCGGTATTAAATCCGCGG
CAGAACCTGACGGCGCCGGGCAATGGCCGTGGGATACAATCCGGGCCGCAGCTGCGCCTCCTGTGTGCCGGCGAT
TCAATCACGGCCGGGACGTTCAGCGAAACCGATGGCGGCGACGGAAATGGCTATAGGCTTCGGCTACGAGACGAC
TTGTCGGCCGACAGGGTTGTCTTTGCAGGAACCGAGACGGCCCCGAACGGGACGATGAACGACGGCTTCTTTGCG
GCCTGGCCCGGCAAGACGATCAAATTCATCACCGACAACATCGGACCGTCGCTGCAGCAGCGCCCAAACGTGATT
CTCTTGCACGCGGGAACCAATGACATGAATCCCGACCCCGCCATCTCGACCGAGGGCAACAATCCGGCCGAGGCG
GTGAAACGACTGGGCGTGCTGGTGGACCGCATGGTCGAGACGTGCCCCGACGCCGTCGTGCTCGTGGCCATGATC
ATCAACACGTGCAACGAGACGCAGGCGCCGGCGACGCAGGAGTTCCAGAGGCAGATCCCAGACATGGTGCGGCAG
AGGTTCGAGGACGGGAGGCGCGTGCTGGCAGCCAACATAACATCCTTTCCCTCGGACCAGCTCAGGGACTGCATC
CACCCGAACAACGACGGGTACCGGCTGCTGGGAGACTACTGGTCCGACTTTGTGAGGCAAGTTCCCGAGGACTGG
CTGCATGATCCTGAGGAGGCCAACAACGCCGGAGAACCGTCGGCGTCAGCTAGTATGCGCCTTGCGCCGTTGCCG
TCAATGTGGCCGATGACGGTGGCCGCGGCCATCGTGGCAGGGAGCATCGTGGGCTGG
Transcript >Ophio5|1611
ATGCGGGCTCCTCTGCTGGCGGTCGCCTGCTGCCTGCTCAGGCTTACCGTCGCCGCCGCGGTTGGCCTAGAAGTC
GCGCTTGAGAGAGATCTGGCCCCGAGGCTGGTGGCAAGGACCAACACTTCTTCCAGCTCGGTATTAAATCCGCGG
CAGAACCTGACGGCGCCGGGCAATGGCCGTGGGATACAATCCGGGCCGCAGCTGCGCCTCCTGTGTGCCGGCGAT
TCAATCACGGCCGGGACGTTCAGCGAAACCGATGGCGGCGACGGAAATGGCTATAGGCTTCGGCTACGAGACGAC
TTGTCGGCCGACAGGGTTGTCTTTGCAGGAACCGAGACGGCCCCGAACGGGACGATGAACGACGGCTTCTTTGCG
GCCTGGCCCGGCAAGACGATCAAATTCATCACCGACAACATCGGACCGTCGCTGCAGCAGCGCCCAAACGTGATT
CTCTTGCACGCGGGAACCAATGACATGAATCCCGACCCCGCCATCTCGACCGAGGGCAACAATCCGGCCGAGGCG
GTGAAACGACTGGGCGTGCTGGTGGACCGCATGGTCGAGACGTGCCCCGACGCCGTCGTGCTCGTGGCCATGATC
ATCAACACGTGCAACGAGACGCAGGCGCCGGCGACGCAGGAGTTCCAGAGGCAGATCCCAGACATGGTGCGGCAG
AGGTTCGAGGACGGGAGGCGCGTGCTGGCAGCCAACATAACATCCTTTCCCTCGGACCAGCTCAGGGACTGCATC
CACCCGAACAACGACGGGTACCGGCTGCTGGGAGACTACTGGTCCGACTTTGTGAGGCAAGTTCCCGAGGACTGG
CTGCATGATCCTGAGGAGGCCAACAACGCCGGAGAACCGTCGGCGTCAGCTAGTATGCGCCTTGCGCCGTTGCCG
TCAATGTGGCCGATGACGGTGGCCGCGGCCATCGTGGCAGGGAGCATCGTGGGCTGGTGA
Gene >Ophio5|1611
ATGCGGGCTCCTCTGCTGGCGGTCGCCTGCTGCCTGCTCAGGCTTACCGTCGCCGCCGCGGTTGGCCTAGAAGTC
GCGCTTGAGAGAGATCTGGCCCCGAGGCTGGTGGCAAGGACCAACACTTCTTCCAGCTCGGTATTAAATCCGCGG
CAGAACCTGACGGCGCCGGGCAATGGCCGTGGGATACAATCCGGGCCGCAGCTGCGCCTCCTGTGTGCCGGCGAT
TCAATCACGGCCGGGACGTTCAGCGAAACCGATGGCGGCGACGGAAATGGCTATAGGCTTCGGCTACGAGACGAC
TTGTCGGGTGAGTCGTGTGCGACGCAGTGACGTTGGGGCGCGAGTGCCAACTGACAGCGGATGTCTCAGCCGACA
GGGTTGTCTTTGCAGGAACCGAGACGGCCCCGAACGGGACGATGAACGACGGCTTCTTTGTAAGTCGACATTGAC
GAGCTTGGTGGCAGGATGCTGACACTCTCGTCTCCTAAAGGCGGCCTGGCCCGGCAAGACGATCAAATTCATCAC
CGACAACATCGGACCGTCGCTGCAGCAGCGCCCAAACGTGATTCTCTTGCACGCGGGAACCAATGACATGAATCC
CGACCCCGCCATCTCGACCGAGGGCAACAATCCGGCCGAGGCGGTGAAACGACTGGGCGTGCTGGTGGACCGCAT
GGTCGAGACGTGCCCCGACGCCGTCGTGCTCGTGGCCATGATCATCAACACGTGCAACGAGACGCAGGCGCCGGC
GACGCAGGAGTTCCAGAGGCAGATCCCAGACATGGTGCGGCAGAGGTTCGAGGACGGGAGGCGCGTGCTGGCAGC
CAACATAACATCCTTTCCCTCGGACCAGCTCAGGGACTGCATCCACCCGAACAACGACGGGTACCGGCTGCTGGG
AGACTACTGGTCCGACTTTGTGAGGCAAGTTCCCGAGGACTGGCTGCATGATCCTGAGGAGGCCAACAACGCCGG
AGAACCGTCGGCGTCAGCTAGTATGCGCCTTGCGCCGTTGCCGTCAATGTGGCCGATGACGGTGGCCGCGGCCAT
CGTGGCAGGGAGCATCGTGGGCTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail