Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1610
Gene name
Locationscaffold_159:20019..24051
Strand-
Gene length (bp)4032
Transcript length (bp)3867
Coding sequence length (bp)3864
Protein length (aa) 1288

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04762 IKI3 IKI3 family 2.7E-295 1 904

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59704|ELP1_SCHPO Elongator complex protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=iki3 PE=3 SV=1 24 1242 0.0E+00
sp|Q06706|ELP1_YEAST Elongator complex protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IKI3 PE=1 SV=1 75 1234 0.0E+00
sp|Q7TT37|ELP1_MOUSE Elongator complex protein 1 OS=Mus musculus GN=Ikbkap PE=1 SV=2 77 1240 2.0E-159
sp|O95163|ELP1_HUMAN Elongator complex protein 1 OS=Homo sapiens GN=IKBKAP PE=1 SV=3 70 1213 1.0E-155
sp|Q8WND5|ELP1_RABIT Elongator complex protein 1 OS=Oryctolagus cuniculus GN=IKBKAP PE=2 SV=1 77 1240 6.0E-153
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59704|ELP1_SCHPO Elongator complex protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=iki3 PE=3 SV=1 24 1242 0.0E+00
sp|Q06706|ELP1_YEAST Elongator complex protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IKI3 PE=1 SV=1 75 1234 0.0E+00
sp|Q7TT37|ELP1_MOUSE Elongator complex protein 1 OS=Mus musculus GN=Ikbkap PE=1 SV=2 77 1240 2.0E-159
sp|O95163|ELP1_HUMAN Elongator complex protein 1 OS=Homo sapiens GN=IKBKAP PE=1 SV=3 70 1213 1.0E-155
sp|Q8WND5|ELP1_RABIT Elongator complex protein 1 OS=Oryctolagus cuniculus GN=IKBKAP PE=2 SV=1 77 1240 6.0E-153
sp|Q8VHU4|ELP1_RAT Elongator complex protein 1 OS=Rattus norvegicus GN=Ikbkap PE=2 SV=1 77 1240 1.0E-152
sp|Q2TAQ1|ELP1_XENLA Putative elongator complex protein 1 OS=Xenopus laevis GN=ikbkap PE=2 SV=1 171 1133 3.0E-130
sp|Q9VGK7|ELP1_DROME Putative elongator complex protein 1 OS=Drosophila melanogaster GN=Elp1 PE=1 SV=2 581 1205 4.0E-65
sp|Q9FNA4|ELP1_ARATH Elongator complex protein 1 OS=Arabidopsis thaliana GN=ELP1 PE=1 SV=1 555 1267 1.0E-48
sp|Q9VGK7|ELP1_DROME Putative elongator complex protein 1 OS=Drosophila melanogaster GN=Elp1 PE=1 SV=2 1 424 2.0E-45
sp|Q9FNA4|ELP1_ARATH Elongator complex protein 1 OS=Arabidopsis thaliana GN=ELP1 PE=1 SV=1 113 450 1.0E-24
[Show less]

GO

GO Term Description Terminal node
GO:0033588 elongator holoenzyme complex Yes
GO:0002098 tRNA wobble uridine modification Yes
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006400 tRNA modification No
GO:0032991 protein-containing complex No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0008033 tRNA processing No
GO:0046483 heterocycle metabolic process No
GO:0043412 macromolecule modification No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0034470 ncRNA processing No
GO:0009987 cellular process No
GO:0140535 intracellular protein-containing complex No
GO:0005575 cellular_component No
GO:0016070 RNA metabolic process No
GO:0006396 RNA processing No
GO:1901360 organic cyclic compound metabolic process No
GO:0009451 RNA modification No
GO:0002097 tRNA wobble base modification No
GO:0006807 nitrogen compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006399 tRNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 51.07 26.43 75.72
CcL In ants, during behavior modification 99.00 46.72 151.28
CcD In ants, recently dead 91.31 43.40 139.23

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.006982 yes
SC16a CcD 0.019620 yes
CcL CcD 0.795046 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1610
MRNLRNAHFVRQTLARASPDSATVCWDPDTNDVLSTIGPTAQRPKIELVRLSDGDSPRTVASWDAPSPNPDLSVD
RVVSIHHVGGSATTCLVLEGGDVITVQEGKSSDDARIEIVGSIDAGIAAAAWSPDEEVLAIVTKADTVIFMTSTF
DPVADVALSSDDLKASKHVSVGWGKKETQFQGRGAKALRDPTIPEKVDQGLPSPHEDGATVISWRGDGAYVAVNS
LRQSDRRVVRIYNRQGELESATEPVDGLEASLSWRPSGNLLAGIQRKADGVDVVFFEKNGLRHGDFSLRCPAGAT
TSNALIRLQWNADSTVLAVIFRHVLQLWTMGNYHWYLKQEIAVHDGLSWLAWHPEKALLFAAVSSGAIITAEHIF
STARGSCRPPYDNGAVAVIDGQTVKLTPFCAANVPPPMSLFDVKADSPVIDVAFGRRNASFAVLHRNGVDIYEMP
LKSGRPVQPQLKAKVPFPDAQGQRLTPLRLCCVAIDTYRCIAFRDAQGCLHFGLNAEAGRMDLLADKRDLVSTST
LDDDASLEGFGQDLSGNLYRLSDPSLEPLSIRFPSHLPWFDIHKSGGVIVAFGLSRNGHLYANQKLLAKNCNSFL
LSPSHLVFTTGNHYVKFVHLTPDVQDLEVPEDEPEKDERCRSVERGSHLVVAIPTNMSLVLQMPRGNVETIFPRA
MVVSGIRDLIEDKNYARAFSYCRTQRVDMNILYDHRPAQFLASVAQFLDQLADVSHIDLFLSSLREEDVTQTMYQ
DTKRPCPQESLALPAAIQAGSKVNTVCDALLKRLESRKTKNLQNILTAHMCKLPPALDDGLALVAELMQEDEKLA
EKAIEHVCFLVDVNRVYENALGLYNLDLALLVAQQLQRDPREYLPFIQNLHTLPELRRRFDIDDHLGRRSKALGS
LQALDAFDELCDYATKHALYQEALKLYRYEAPRLQTLTRLYAAHLESQSAYREAGLAYESLNDYAKATSCYRAAG
ATCWQECLFTAQMQSPSLSSDAMVDLATSLADALWEGKDYSAAATIHLDHLSSVETAVKCLCKGYMFAEAIRLVV
QRGRPELLETTVDVDLAEALGSTTEFLADCKAQLLSQVPRIAELRRKAAEDPLSFYEGDRLGGLGIPDDVSVTAS
SRLSTSASLFTRYTGTVGTVGTGVSRATSKNRRREEKKRARGRKGTVYEEEYLVNSVRRLVERVGTAAAEVERLV
FALVRRGMAERARAAEALMAAVVDACQGAVANVFIGPTSTDEPKHNNEEADEWKATGGDAVLHDWMLGQSKRLEP
PLVPAMKKLVLIG
Coding >Ophio5|1610
ATGCGAAACCTCCGCAACGCCCATTTCGTCCGCCAGACGCTCGCTCGCGCCTCGCCAGACTCTGCGACGGTCTGC
TGGGATCCAGACACGAATGACGTCCTCTCCACTATCGGGCCCACGGCTCAGCGCCCAAAGATAGAGCTTGTCAGA
CTCTCGGACGGCGATTCGCCCCGGACCGTTGCTAGCTGGGACGCACCCAGTCCAAACCCGGACTTGTCTGTGGAT
AGGGTCGTCAGCATTCACCATGTTGGCGGCTCCGCGACGACCTGTCTCGTTCTCGAGGGCGGCGATGTCATCACT
GTCCAGGAGGGGAAGTCCTCTGATGACGCCCGCATCGAGATCGTCGGCTCCATCGACGCCGGCATCGCTGCAGCG
GCCTGGTCTCCCGACGAGGAGGTCCTCGCCATCGTAACCAAGGCCGACACGGTCATCTTCATGACCAGTACCTTT
GATCCCGTCGCTGACGTCGCCCTGAGCTCAGACGATCTGAAAGCCTCCAAACACGTCTCTGTCGGCTGGGGGAAA
AAGGAGACGCAATTCCAGGGCCGGGGAGCCAAGGCCCTGCGAGATCCTACCATACCCGAAAAAGTTGACCAAGGC
TTGCCGAGTCCGCACGAGGACGGCGCCACTGTCATCAGTTGGCGAGGCGACGGTGCCTATGTCGCCGTCAACTCT
TTGCGGCAATCCGACCGCCGAGTTGTTCGCATTTACAATCGACAAGGTGAACTCGAGAGCGCCACTGAGCCTGTC
GATGGCCTGGAAGCTTCTCTCAGCTGGCGGCCGTCGGGAAATTTGCTTGCCGGCATTCAGCGCAAAGCCGATGGC
GTCGACGTCGTTTTCTTCGAGAAGAATGGCCTTCGCCATGGTGATTTTTCTTTACGCTGTCCCGCGGGCGCGACT
ACGTCTAACGCCCTGATCCGACTGCAGTGGAACGCCGACTCGACCGTTCTCGCTGTTATCTTTCGCCATGTGCTG
CAGCTCTGGACCATGGGTAACTATCACTGGTACCTCAAGCAAGAGATTGCTGTGCACGACGGCCTCTCCTGGCTT
GCCTGGCACCCCGAGAAAGCTCTCCTCTTTGCTGCAGTTTCCTCCGGGGCCATCATCACGGCGGAACACATCTTT
AGCACCGCTCGAGGAAGCTGTCGACCTCCTTACGACAACGGCGCGGTGGCGGTCATCGACGGCCAGACTGTCAAG
TTGACTCCCTTCTGTGCTGCCAATGTGCCGCCACCAATGTCTCTTTTTGACGTTAAAGCCGACTCTCCCGTGATA
GACGTAGCCTTTGGTCGCCGCAATGCGTCCTTTGCCGTCTTGCATCGGAACGGTGTCGACATCTACGAGATGCCA
CTGAAAAGCGGACGCCCCGTTCAACCCCAGCTCAAAGCGAAGGTGCCATTTCCTGACGCCCAAGGGCAGAGACTG
ACGCCCTTGCGGCTTTGCTGCGTCGCCATTGACACTTACCGTTGCATTGCCTTTCGAGACGCTCAGGGCTGCTTG
CATTTCGGCCTTAACGCAGAGGCTGGTCGGATGGACCTTTTGGCGGACAAGCGAGATTTGGTATCCACCTCGACG
TTGGATGATGACGCCTCGCTGGAGGGATTCGGACAAGATCTGTCGGGAAACCTCTACAGGTTGTCAGATCCCTCT
TTGGAGCCGTTGTCGATCCGGTTCCCGTCCCATCTTCCTTGGTTTGACATACACAAGTCAGGCGGTGTCATCGTG
GCCTTTGGACTATCGAGAAACGGCCATCTTTACGCCAATCAGAAGTTGCTGGCCAAGAACTGCAACTCGTTTCTT
CTCTCGCCGAGCCACCTCGTCTTCACAACCGGTAACCACTACGTCAAGTTTGTGCACTTGACCCCTGACGTCCAA
GATCTAGAAGTTCCCGAGGACGAGCCTGAAAAGGACGAACGATGTCGAAGCGTCGAGCGCGGCTCTCACTTGGTT
GTCGCCATACCGACCAACATGAGCCTCGTACTGCAAATGCCGAGGGGAAACGTCGAAACCATCTTTCCGCGAGCC
ATGGTCGTCTCCGGGATTCGCGACCTCATCGAGGACAAGAATTACGCCCGGGCCTTTTCCTATTGCCGCACCCAG
CGCGTCGACATGAATATCCTGTACGATCACCGTCCTGCACAGTTCTTGGCCAGCGTGGCGCAATTCCTCGACCAG
CTCGCAGACGTATCGCACATCGATCTGTTCTTGTCGTCTCTTCGTGAGGAGGATGTGACGCAGACCATGTATCAG
GACACGAAGCGGCCATGTCCGCAGGAGTCTCTTGCTCTCCCTGCTGCGATACAGGCTGGCTCCAAGGTGAACACT
GTGTGCGACGCCCTGCTTAAGCGGCTGGAGTCTCGCAAGACCAAGAACCTCCAGAATATCCTGACAGCCCACATG
TGCAAGCTGCCGCCGGCGCTGGACGACGGATTGGCCCTCGTGGCGGAGCTGATGCAGGAGGATGAGAAACTGGCC
GAAAAGGCGATTGAACACGTCTGCTTCCTGGTGGACGTCAATCGCGTGTATGAGAATGCGCTCGGGTTGTACAAC
CTCGACCTCGCGTTGCTGGTTGCACAGCAGTTGCAACGAGATCCACGCGAATATCTTCCCTTTATTCAAAACCTT
CACACTCTGCCTGAACTACGTCGCCGATTCGATATCGATGATCATCTCGGCCGTCGATCCAAGGCTCTCGGGAGC
CTTCAGGCACTCGATGCCTTTGACGAGCTGTGCGACTATGCGACCAAGCATGCCCTGTACCAGGAGGCCCTCAAA
CTCTACCGCTATGAGGCGCCTCGCCTTCAGACTCTAACCCGTCTTTATGCCGCCCACCTCGAATCGCAGTCGGCC
TACCGCGAGGCAGGTCTCGCCTACGAATCCCTCAACGACTATGCCAAAGCGACGAGTTGTTACCGCGCGGCCGGT
GCGACCTGCTGGCAGGAATGTCTCTTCACAGCGCAAATGCAGTCTCCCAGCCTGTCATCCGATGCCATGGTCGAC
CTGGCTACGAGCCTTGCGGATGCTCTCTGGGAAGGCAAAGACTACAGCGCGGCTGCAACCATCCACCTGGATCAC
CTCTCGTCCGTCGAAACCGCCGTCAAGTGCCTCTGCAAGGGGTACATGTTTGCCGAGGCCATCCGACTCGTCGTT
CAGCGAGGCCGCCCGGAGCTCCTTGAGACGACGGTAGACGTCGACCTCGCAGAAGCCCTCGGCAGCACAACCGAG
TTCCTCGCGGACTGCAAAGCTCAGCTCCTCTCCCAGGTGCCCCGGATTGCCGAGCTGCGGCGCAAGGCAGCCGAA
GATCCGCTGAGCTTCTACGAGGGGGACCGCCTCGGCGGGCTCGGCATCCCCGACGATGTCTCTGTCACGGCCAGC
TCGCGGCTGAGTACCAGCGCCAGTCTCTTCACCCGCTATACGGGCACCGTCGGCACCGTCGGAACGGGCGTCAGC
CGAGCGACGAGCAAGAACCGGCGACGCGAAGAGAAGAAGCGCGCGCGAGGTCGAAAAGGGACCGTCTACGAGGAG
GAATATCTCGTCAACAGCGTCCGCCGTCTGGTGGAGCGAGTCGGCACCGCGGCCGCCGAGGTCGAACGGCTGGTC
TTTGCCCTTGTCCGGCGCGGCATGGCGGAGCGCGCGCGCGCTGCTGAGGCGCTCATGGCCGCTGTTGTCGATGCG
TGCCAAGGTGCCGTCGCCAACGTCTTTATAGGCCCTACTAGTACGGACGAGCCGAAGCACAACAACGAGGAGGCG
GACGAATGGAAGGCTACTGGCGGCGACGCAGTGCTGCACGACTGGATGCTCGGCCAGAGCAAGAGGCTGGAGCCT
CCGCTGGTGCCGGCCATGAAGAAGCTGGTTCTCATCGGC
Transcript >Ophio5|1610
ATGCGAAACCTCCGCAACGCCCATTTCGTCCGCCAGACGCTCGCTCGCGCCTCGCCAGACTCTGCGACGGTCTGC
TGGGATCCAGACACGAATGACGTCCTCTCCACTATCGGGCCCACGGCTCAGCGCCCAAAGATAGAGCTTGTCAGA
CTCTCGGACGGCGATTCGCCCCGGACCGTTGCTAGCTGGGACGCACCCAGTCCAAACCCGGACTTGTCTGTGGAT
AGGGTCGTCAGCATTCACCATGTTGGCGGCTCCGCGACGACCTGTCTCGTTCTCGAGGGCGGCGATGTCATCACT
GTCCAGGAGGGGAAGTCCTCTGATGACGCCCGCATCGAGATCGTCGGCTCCATCGACGCCGGCATCGCTGCAGCG
GCCTGGTCTCCCGACGAGGAGGTCCTCGCCATCGTAACCAAGGCCGACACGGTCATCTTCATGACCAGTACCTTT
GATCCCGTCGCTGACGTCGCCCTGAGCTCAGACGATCTGAAAGCCTCCAAACACGTCTCTGTCGGCTGGGGGAAA
AAGGAGACGCAATTCCAGGGCCGGGGAGCCAAGGCCCTGCGAGATCCTACCATACCCGAAAAAGTTGACCAAGGC
TTGCCGAGTCCGCACGAGGACGGCGCCACTGTCATCAGTTGGCGAGGCGACGGTGCCTATGTCGCCGTCAACTCT
TTGCGGCAATCCGACCGCCGAGTTGTTCGCATTTACAATCGACAAGGTGAACTCGAGAGCGCCACTGAGCCTGTC
GATGGCCTGGAAGCTTCTCTCAGCTGGCGGCCGTCGGGAAATTTGCTTGCCGGCATTCAGCGCAAAGCCGATGGC
GTCGACGTCGTTTTCTTCGAGAAGAATGGCCTTCGCCATGGTGATTTTTCTTTACGCTGTCCCGCGGGCGCGACT
ACGTCTAACGCCCTGATCCGACTGCAGTGGAACGCCGACTCGACCGTTCTCGCTGTTATCTTTCGCCATGTGCTG
CAGCTCTGGACCATGGGTAACTATCACTGGTACCTCAAGCAAGAGATTGCTGTGCACGACGGCCTCTCCTGGCTT
GCCTGGCACCCCGAGAAAGCTCTCCTCTTTGCTGCAGTTTCCTCCGGGGCCATCATCACGGCGGAACACATCTTT
AGCACCGCTCGAGGAAGCTGTCGACCTCCTTACGACAACGGCGCGGTGGCGGTCATCGACGGCCAGACTGTCAAG
TTGACTCCCTTCTGTGCTGCCAATGTGCCGCCACCAATGTCTCTTTTTGACGTTAAAGCCGACTCTCCCGTGATA
GACGTAGCCTTTGGTCGCCGCAATGCGTCCTTTGCCGTCTTGCATCGGAACGGTGTCGACATCTACGAGATGCCA
CTGAAAAGCGGACGCCCCGTTCAACCCCAGCTCAAAGCGAAGGTGCCATTTCCTGACGCCCAAGGGCAGAGACTG
ACGCCCTTGCGGCTTTGCTGCGTCGCCATTGACACTTACCGTTGCATTGCCTTTCGAGACGCTCAGGGCTGCTTG
CATTTCGGCCTTAACGCAGAGGCTGGTCGGATGGACCTTTTGGCGGACAAGCGAGATTTGGTATCCACCTCGACG
TTGGATGATGACGCCTCGCTGGAGGGATTCGGACAAGATCTGTCGGGAAACCTCTACAGGTTGTCAGATCCCTCT
TTGGAGCCGTTGTCGATCCGGTTCCCGTCCCATCTTCCTTGGTTTGACATACACAAGTCAGGCGGTGTCATCGTG
GCCTTTGGACTATCGAGAAACGGCCATCTTTACGCCAATCAGAAGTTGCTGGCCAAGAACTGCAACTCGTTTCTT
CTCTCGCCGAGCCACCTCGTCTTCACAACCGGTAACCACTACGTCAAGTTTGTGCACTTGACCCCTGACGTCCAA
GATCTAGAAGTTCCCGAGGACGAGCCTGAAAAGGACGAACGATGTCGAAGCGTCGAGCGCGGCTCTCACTTGGTT
GTCGCCATACCGACCAACATGAGCCTCGTACTGCAAATGCCGAGGGGAAACGTCGAAACCATCTTTCCGCGAGCC
ATGGTCGTCTCCGGGATTCGCGACCTCATCGAGGACAAGAATTACGCCCGGGCCTTTTCCTATTGCCGCACCCAG
CGCGTCGACATGAATATCCTGTACGATCACCGTCCTGCACAGTTCTTGGCCAGCGTGGCGCAATTCCTCGACCAG
CTCGCAGACGTATCGCACATCGATCTGTTCTTGTCGTCTCTTCGTGAGGAGGATGTGACGCAGACCATGTATCAG
GACACGAAGCGGCCATGTCCGCAGGAGTCTCTTGCTCTCCCTGCTGCGATACAGGCTGGCTCCAAGGTGAACACT
GTGTGCGACGCCCTGCTTAAGCGGCTGGAGTCTCGCAAGACCAAGAACCTCCAGAATATCCTGACAGCCCACATG
TGCAAGCTGCCGCCGGCGCTGGACGACGGATTGGCCCTCGTGGCGGAGCTGATGCAGGAGGATGAGAAACTGGCC
GAAAAGGCGATTGAACACGTCTGCTTCCTGGTGGACGTCAATCGCGTGTATGAGAATGCGCTCGGGTTGTACAAC
CTCGACCTCGCGTTGCTGGTTGCACAGCAGTTGCAACGAGATCCACGCGAATATCTTCCCTTTATTCAAAACCTT
CACACTCTGCCTGAACTACGTCGCCGATTCGATATCGATGATCATCTCGGCCGTCGATCCAAGGCTCTCGGGAGC
CTTCAGGCACTCGATGCCTTTGACGAGCTGTGCGACTATGCGACCAAGCATGCCCTGTACCAGGAGGCCCTCAAA
CTCTACCGCTATGAGGCGCCTCGCCTTCAGACTCTAACCCGTCTTTATGCCGCCCACCTCGAATCGCAGTCGGCC
TACCGCGAGGCAGGTCTCGCCTACGAATCCCTCAACGACTATGCCAAAGCGACGAGTTGTTACCGCGCGGCCGGT
GCGACCTGCTGGCAGGAATGTCTCTTCACAGCGCAAATGCAGTCTCCCAGCCTGTCATCCGATGCCATGGTCGAC
CTGGCTACGAGCCTTGCGGATGCTCTCTGGGAAGGCAAAGACTACAGCGCGGCTGCAACCATCCACCTGGATCAC
CTCTCGTCCGTCGAAACCGCCGTCAAGTGCCTCTGCAAGGGGTACATGTTTGCCGAGGCCATCCGACTCGTCGTT
CAGCGAGGCCGCCCGGAGCTCCTTGAGACGACGGTAGACGTCGACCTCGCAGAAGCCCTCGGCAGCACAACCGAG
TTCCTCGCGGACTGCAAAGCTCAGCTCCTCTCCCAGGTGCCCCGGATTGCCGAGCTGCGGCGCAAGGCAGCCGAA
GATCCGCTGAGCTTCTACGAGGGGGACCGCCTCGGCGGGCTCGGCATCCCCGACGATGTCTCTGTCACGGCCAGC
TCGCGGCTGAGTACCAGCGCCAGTCTCTTCACCCGCTATACGGGCACCGTCGGCACCGTCGGAACGGGCGTCAGC
CGAGCGACGAGCAAGAACCGGCGACGCGAAGAGAAGAAGCGCGCGCGAGGTCGAAAAGGGACCGTCTACGAGGAG
GAATATCTCGTCAACAGCGTCCGCCGTCTGGTGGAGCGAGTCGGCACCGCGGCCGCCGAGGTCGAACGGCTGGTC
TTTGCCCTTGTCCGGCGCGGCATGGCGGAGCGCGCGCGCGCTGCTGAGGCGCTCATGGCCGCTGTTGTCGATGCG
TGCCAAGGTGCCGTCGCCAACGTCTTTATAGGCCCTACTAGTACGGACGAGCCGAAGCACAACAACGAGGAGGCG
GACGAATGGAAGGCTACTGGCGGCGACGCAGTGCTGCACGACTGGATGCTCGGCCAGAGCAAGAGGCTGGAGCCT
CCGCTGGTGCCGGCCATGAAGAAGCTGGTTCTCATCGGCTGA
Gene >Ophio5|1610
ATGCGAAACCTCCGCAACGCCCATTTCGTCCGCCAGACGCTCGCTCGCGCCTCGCCAGACTCTGCGACGGTCTGC
TGGGATCCAGACACGAATGACGTCCTCTCCACTATCGGGCCCACGGCTCAGCGCCCAAAGATAGAGCTTGTCAGA
CTCTCGGACGGCGAGTGAGTATACTCTTCCACGTTTCGGATTCGCCGCTGACTGTACCTCGCCCAGTTCGCCCCG
GACCGTTGCTAGCTGGGACGCACCCAGTCCAAACCCGGACTTGTCTGTGGATAGGGTCGTCAGCATTCACCATGT
TGGCGGCTCCGCGACGACCTGTCTCGTTCTCGAGGGCGGCGATGTCATCACTGTCCAGGAGGGGAAGTCCTCTGA
TGACGCCCGCATCGAGATCGTCGGCTCCATCGACGCCGGCATCGCTGCAGCGGCCTGGTCTCCCGACGAGGAGGT
CCTCGCCATCGTAACCAAGGCCGACACGGTCATCTTCATGACCAGTACCTTTGATCCCGTCGCTGACGTCGCCCT
GAGCTCAGACGATCTGAAAGCCTCCAAACACGTCTCTGTCGGCTGGGGGAAAAAGGAGACGCAATTCCAGGGCCG
GGGAGCCAAGGCCCTGCGAGATCCTACCATACCCGAAAAAGTTGACCAAGGCTTGCCGAGTCCGCACGAGGACGG
CGCCACTGTCATCAGTTGGCGAGGCGACGGTGCCTATGTCGCCGTCAACTCTTTGCGGCAATCCGACCGCCGAGT
TGTTCGCATTTACAATCGACAAGGTGAACTCGAGAGCGCCACTGAGCCTGTCGATGGCCTGGAAGCTTCTCTCAG
CTGGCGGCCGTCGGGAAATTTGCTTGCCGGCATTCAGCGCAAAGCCGATGGCGTCGACGTCGTTTTCTTCGAGAA
GAATGGCCTTCGCCATGGTGATTTTTCTTTACGCTGTCCCGCGGGCGCGACTACGTCTAACGCCCTGATCCGACT
GCAGTGGAACGCCGACTCGACCGTTCTCGCTGTTATCTTTCGCCATGTGCTGCAGCTCTGGACCATGGGTAACTA
TCACTGGTACCTCAAGCAAGAGATTGCTGTGCACGACGGCCTCTCCTGGCTTGCCTGGCACCCCGAGAAAGCTCT
CCTCTTTGCTGCAGTTTCCTCCGGGGCCATCATCACGGCGGAACACATCTTTAGCACCGCTCGAGGAAGCTGTCG
ACCTCCTTACGACAACGGCGCGGTGGCGGTCATCGACGGCCAGACTGTCAAGTTGACTCCCTTCTGTGCTGCCAA
TGTGCCGCCACCAATGTCTCTTTTTGACGTTAAAGCCGACTCTCCCGTGATAGACGTAGCCTTTGGTCGCCGCAA
TGCGTCCTTTGCCGTCTTGCATCGGAACGGTGTCGACATCTACGAGATGCCACTGAAAAGCGGACGCCCCGTTCA
ACCCCAGCTCAAAGCGAAGGTGCCATTTCCTGACGCCCAAGGGCAGAGACTGACGCCCTTGCGGCTTTGCTGCGT
CGCCATTGACACTTACCGTTGCATTGCCTTTCGAGACGCTCAGGGCTGCTTGCATTTCGGCCTTAACGCAGAGGC
TGGTCGGATGGACCTTTTGGCGGACAAGCGAGATTTGGTATCCACCTCGACGTTGGATGATGACGCCTCGCTGGA
GGGATTCGGACAAGATCTGTCGGGAAACCTCTACAGGTTGTCAGATCCCTCTTTGGAGCCGTTGTCGATCCGGTT
CCCGTCCCATCTTCCTTGGTTTGACATACACAAGTCAGGCGGTGTCATCGTGGCCTTTGGACTATCGAGAAACGG
CCATCTTTACGCCAATCAGAAGTTGCTGGCCAAGAACTGCAACTCGTTTCTTCTCTCGCCGAGCCACCTCGTCTT
CACAACCGGTAACCACTACGTCAAGTTTGTGCACTTGACCCCTGACGTCCAAGGTGCCGTTCCCTTGGTCAAAAC
AATGACATTCGGCCCCTCCCACTGACTTGTTTGCCAGATCTAGAAGTTCCCGAGGACGAGCCTGAAAAGGACGAA
CGATGTCGAAGCGTCGAGCGCGGCTCTCACTTGGTTGTCGCCATACCGACCAACATGAGCCTCGTACTGCAAATG
CCGAGGGGAAACGTCGAAACCATCTTTCCGCGAGCCATGGTCGTCTCCGGGATTCGCGACCTCATCGAGGACAAG
AATTACGCCCGGGCCTTTTCCTATTGCCGCACCCAGCGCGTCGACATGAATATCCTGTACGATCACCGTCCTGCA
CAGTTCTTGGCCAGCGTGGCGCAATTCCTCGACCAGCTCGCAGACGTATCGCACATCGATCTGTTCTTGTCGTCT
CTTCGGTGAGGCTCTCCTTTATCACCATTGCGTCGCTCACCGCATTGACGAGAAGACAGTGAGGAGGATGTGACG
CAGACCATGTATCAGGACACGAAGCGGCCATGTCCGCAGGAGTCTCTTGCTCTCCCTGCTGCGATACAGGCTGGC
TCCAAGGTGAACACTGTGTGCGACGCCCTGCTTAAGCGGCTGGAGTCTCGCAAGACCAAGAACCTCCAGAATATC
CTGACAGCCCACATGTGCAAGCTGCCGCCGGCGCTGGACGACGGATTGGCCCTCGTGGCGGAGCTGATGCAGGAG
GATGAGAAACTGGCCGAAAAGGCGATTGAACACGTCTGCTTCCTGGTGGACGTCAATCGCGTGTATGAGAATGCG
CTCGGGTTGTACAACCTCGACCTCGCGTTGCTGGTTGCACAGCAGTTGCAACGAGATCCACGCGAATATCTTCCC
TTTATTCAAAACCTTCACACTCTGCCTGAACTACGTCGCCGATTCGATATCGATGATCATCTCGGCCGTCGATCC
AAGGCTCTCGGGAGCCTTCAGGCACTCGATGCCTTTGACGAGCTGTGCGACTATGCGACCAAGCATGCCCTGTAC
CAGGAGGCCCTCAAACTCTACCGCTATGAGGCGCCTCGCCTTCAGACTCTAACCCGTCTTTATGCCGCCCACCTC
GAATCGCAGTCGGCCTACCGCGAGGCAGGTCTCGCCTACGAATCCCTCAACGACTATGCCAAAGCGACGAGTTGT
TACCGCGCGGCCGGTGCGACCTGCTGGCAGGAATGTCTCTTCACAGCGCAAATGCAGTCTCCCAGCCTGTCATCC
GATGCCATGGTCGACCTGGCTACGAGCCTTGCGGATGCTCTCTGGGAAGGCAAAGACTACAGCGCGGCTGCAACC
ATCCACCTGGATCACCTCTCGTCCGTCGAAACCGCCGTCAAGTGCCTCTGCAAGGGGTACATGTTTGCCGAGGCC
ATCCGACTCGTCGTTCAGCGAGGCCGCCCGGAGCTCCTTGAGACGACGGTAGACGTCGACCTCGCAGAAGCCCTC
GGCAGCACAACCGAGTTCCTCGCGGACTGCAAAGCTCAGCTCCTCTCCCAGGTGCCCCGGATTGCCGAGCTGCGG
CGCAAGGCAGCCGAAGATCCGCTGAGCTTCTACGAGGGGGACCGCCTCGGCGGGCTCGGCATCCCCGACGATGTC
TCTGTCACGGCCAGCTCGCGGCTGAGTACCAGCGCCAGTCTCTTCACCCGCTATACGGGCACCGTCGGCACCGTC
GGAACGGGCGTCAGCCGAGCGACGAGCAAGAACCGGCGACGCGAAGAGAAGAAGCGCGCGCGAGGTCGAAAAGGG
ACCGTCTACGAGGAGGAATATCTCGTCAACAGCGTCCGCCGTCTGGTGGAGCGAGTCGGCACCGCGGCCGCCGAG
GTCGAACGGCTGGTCTTTGCCCTTGTCCGGCGCGGCATGGCGGAGCGCGCGCGCGCTGCTGAGGCGCTCATGGCC
GCTGTTGTCGATGCGTGCCAAGGTGCCGTCGCCAACGTCTTTATAGGCCCTACTAGTACGGACGAGCCGAAGCAC
AACAACGAGGAGGCGGACGAATGGAAGGCTACTGGCGGCGACGCAGTGCTGCACGACTGGATGCTCGGCCAGAGC
AAGAGGCTGGAGCCTCCGCTGGTGCCGGCCATGAAGAAGCTGGTTCTCATCGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail