Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1610
Gene name
Locationscaffold_159:20019..24051
Strand-
Gene length (bp)4032
Transcript length (bp)3867
Coding sequence length (bp)3864
Protein length (aa) 1288

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04762 IKI3 IKI3 family 2.7E-295 1 904

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59704|ELP1_SCHPO Elongator complex protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=iki3 PE=3 SV=1 24 1242 0.0E+00
sp|Q06706|ELP1_YEAST Elongator complex protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IKI3 PE=1 SV=1 75 1234 0.0E+00
sp|Q7TT37|ELP1_MOUSE Elongator complex protein 1 OS=Mus musculus GN=Ikbkap PE=1 SV=2 77 1240 2.0E-159
sp|O95163|ELP1_HUMAN Elongator complex protein 1 OS=Homo sapiens GN=IKBKAP PE=1 SV=3 70 1213 1.0E-155
sp|Q8WND5|ELP1_RABIT Elongator complex protein 1 OS=Oryctolagus cuniculus GN=IKBKAP PE=2 SV=1 77 1240 6.0E-153
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59704|ELP1_SCHPO Elongator complex protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=iki3 PE=3 SV=1 24 1242 0.0E+00
sp|Q06706|ELP1_YEAST Elongator complex protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IKI3 PE=1 SV=1 75 1234 0.0E+00
sp|Q7TT37|ELP1_MOUSE Elongator complex protein 1 OS=Mus musculus GN=Ikbkap PE=1 SV=2 77 1240 2.0E-159
sp|O95163|ELP1_HUMAN Elongator complex protein 1 OS=Homo sapiens GN=IKBKAP PE=1 SV=3 70 1213 1.0E-155
sp|Q8WND5|ELP1_RABIT Elongator complex protein 1 OS=Oryctolagus cuniculus GN=IKBKAP PE=2 SV=1 77 1240 6.0E-153
sp|Q8VHU4|ELP1_RAT Elongator complex protein 1 OS=Rattus norvegicus GN=Ikbkap PE=2 SV=1 77 1240 1.0E-152
sp|Q2TAQ1|ELP1_XENLA Putative elongator complex protein 1 OS=Xenopus laevis GN=ikbkap PE=2 SV=1 171 1133 3.0E-130
sp|Q9VGK7|ELP1_DROME Putative elongator complex protein 1 OS=Drosophila melanogaster GN=Elp1 PE=1 SV=2 581 1205 4.0E-65
sp|Q9FNA4|ELP1_ARATH Elongator complex protein 1 OS=Arabidopsis thaliana GN=ELP1 PE=1 SV=1 555 1267 1.0E-48
sp|Q9VGK7|ELP1_DROME Putative elongator complex protein 1 OS=Drosophila melanogaster GN=Elp1 PE=1 SV=2 1 424 2.0E-45
sp|Q9FNA4|ELP1_ARATH Elongator complex protein 1 OS=Arabidopsis thaliana GN=ELP1 PE=1 SV=1 113 450 1.0E-24
[Show less]

GO

GO Term Description Terminal node
GO:0033588 elongator holoenzyme complex Yes
GO:0002098 tRNA wobble uridine modification Yes
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006400 tRNA modification No
GO:0032991 protein-containing complex No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0008033 tRNA processing No
GO:0046483 heterocycle metabolic process No
GO:0043412 macromolecule modification No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0034470 ncRNA processing No
GO:0009987 cellular process No
GO:0140535 intracellular protein-containing complex No
GO:0005575 cellular_component No
GO:0016070 RNA metabolic process No
GO:0006396 RNA processing No
GO:1901360 organic cyclic compound metabolic process No
GO:0009451 RNA modification No
GO:0002097 tRNA wobble base modification No
GO:0006807 nitrogen compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006399 tRNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1610
MRNLRNAHFVRQTLARASPDSATVCWDPDTNDVLSTIGPTAQRPKIELVRLSDGDSPRTVASWDAPSPNPDLSVD
RVVSIHHVGGSATTCLVLEGGDVITVQEGKSSDDARIEIVGSIDAGIAAAAWSPDEEVLAIVTKADTVIFMTSTF
DPVADVALSSDDLKASKHVSVGWGKKETQFQGRGAKALRDPTIPEKVDQGLPSPHEDGATVISWRGDGAYVAVNS
LRQSDRRVVRIYNRQGELESATEPVDGLEASLSWRPSGNLLAGIQRKADGVDVVFFEKNGLRHGDFSLRCPAGAT
TSNALIRLQWNADSTVLAVIFRHVLQLWTMGNYHWYLKQEIAVHDGLSWLAWHPEKALLFAAVSSGAIITAEHIF
STARGSCRPPYDNGAVAVIDGQTVKLTPFCAANVPPPMSLFDVKADSPVIDVAFGRRNASFAVLHRNGVDIYEMP
LKSGRPVQPQLKAKVPFPDAQGQRLTPLRLCCVAIDTYRCIAFRDAQGCLHFGLNAEAGRMDLLADKRDLVSTST
LDDDASLEGFGQDLSGNLYRLSDPSLEPLSIRFPSHLPWFDIHKSGGVIVAFGLSRNGHLYANQKLLAKNCNSFL
LSPSHLVFTTGNHYVKFVHLTPDVQDLEVPEDEPEKDERCRSVERGSHLVVAIPTNMSLVLQMPRGNVETIFPRA
MVVSGIRDLIEDKNYARAFSYCRTQRVDMNILYDHRPAQFLASVAQFLDQLADVSHIDLFLSSLREEDVTQTMYQ
DTKRPCPQESLALPAAIQAGSKVNTVCDALLKRLESRKTKNLQNILTAHMCKLPPALDDGLALVAELMQEDEKLA
EKAIEHVCFLVDVNRVYENALGLYNLDLALLVAQQLQRDPREYLPFIQNLHTLPELRRRFDIDDHLGRRSKALGS
LQALDAFDELCDYATKHALYQEALKLYRYEAPRLQTLTRLYAAHLESQSAYREAGLAYESLNDYAKATSCYRAAG
ATCWQECLFTAQMQSPSLSSDAMVDLATSLADALWEGKDYSAAATIHLDHLSSVETAVKCLCKGYMFAEAIRLVV
QRGRPELLETTVDVDLAEALGSTTEFLADCKAQLLSQVPRIAELRRKAAEDPLSFYEGDRLGGLGIPDDVSVTAS
SRLSTSASLFTRYTGTVGTVGTGVSRATSKNRRREEKKRARGRKGTVYEEEYLVNSVRRLVERVGTAAAEVERLV
FALVRRGMAERARAAEALMAAVVDACQGAVANVFIGPTSTDEPKHNNEEADEWKATGGDAVLHDWMLGQSKRLEP
PLVPAMKKLVLIG
Coding >Ophio5|1610
ATGCGAAACCTCCGCAACGCCCATTTCGTCCGCCAGACGCTCGCTCGCGCCTCGCCAGACTCTGCGACGGTCTGC
TGGGATCCAGACACGAATGACGTCCTCTCCACTATCGGGCCCACGGCTCAGCGCCCAAAGATAGAGCTTGTCAGA
CTCTCGGACGGCGATTCGCCCCGGACCGTTGCTAGCTGGGACGCACCCAGTCCAAACCCGGACTTGTCTGTGGAT
AGGGTCGTCAGCATTCACCATGTTGGCGGCTCCGCGACGACCTGTCTCGTTCTCGAGGGCGGCGATGTCATCACT
GTCCAGGAGGGGAAGTCCTCTGATGACGCCCGCATCGAGATCGTCGGCTCCATCGACGCCGGCATCGCTGCAGCG
GCCTGGTCTCCCGACGAGGAGGTCCTCGCCATCGTAACCAAGGCCGACACGGTCATCTTCATGACCAGTACCTTT
GATCCCGTCGCTGACGTCGCCCTGAGCTCAGACGATCTGAAAGCCTCCAAACACGTCTCTGTCGGCTGGGGGAAA
AAGGAGACGCAATTCCAGGGCCGGGGAGCCAAGGCCCTGCGAGATCCTACCATACCCGAAAAAGTTGACCAAGGC
TTGCCGAGTCCGCACGAGGACGGCGCCACTGTCATCAGTTGGCGAGGCGACGGTGCCTATGTCGCCGTCAACTCT
TTGCGGCAATCCGACCGCCGAGTTGTTCGCATTTACAATCGACAAGGTGAACTCGAGAGCGCCACTGAGCCTGTC
GATGGCCTGGAAGCTTCTCTCAGCTGGCGGCCGTCGGGAAATTTGCTTGCCGGCATTCAGCGCAAAGCCGATGGC
GTCGACGTCGTTTTCTTCGAGAAGAATGGCCTTCGCCATGGTGATTTTTCTTTACGCTGTCCCGCGGGCGCGACT
ACGTCTAACGCCCTGATCCGACTGCAGTGGAACGCCGACTCGACCGTTCTCGCTGTTATCTTTCGCCATGTGCTG
CAGCTCTGGACCATGGGTAACTATCACTGGTACCTCAAGCAAGAGATTGCTGTGCACGACGGCCTCTCCTGGCTT
GCCTGGCACCCCGAGAAAGCTCTCCTCTTTGCTGCAGTTTCCTCCGGGGCCATCATCACGGCGGAACACATCTTT
AGCACCGCTCGAGGAAGCTGTCGACCTCCTTACGACAACGGCGCGGTGGCGGTCATCGACGGCCAGACTGTCAAG
TTGACTCCCTTCTGTGCTGCCAATGTGCCGCCACCAATGTCTCTTTTTGACGTTAAAGCCGACTCTCCCGTGATA
GACGTAGCCTTTGGTCGCCGCAATGCGTCCTTTGCCGTCTTGCATCGGAACGGTGTCGACATCTACGAGATGCCA
CTGAAAAGCGGACGCCCCGTTCAACCCCAGCTCAAAGCGAAGGTGCCATTTCCTGACGCCCAAGGGCAGAGACTG
ACGCCCTTGCGGCTTTGCTGCGTCGCCATTGACACTTACCGTTGCATTGCCTTTCGAGACGCTCAGGGCTGCTTG
CATTTCGGCCTTAACGCAGAGGCTGGTCGGATGGACCTTTTGGCGGACAAGCGAGATTTGGTATCCACCTCGACG
TTGGATGATGACGCCTCGCTGGAGGGATTCGGACAAGATCTGTCGGGAAACCTCTACAGGTTGTCAGATCCCTCT
TTGGAGCCGTTGTCGATCCGGTTCCCGTCCCATCTTCCTTGGTTTGACATACACAAGTCAGGCGGTGTCATCGTG
GCCTTTGGACTATCGAGAAACGGCCATCTTTACGCCAATCAGAAGTTGCTGGCCAAGAACTGCAACTCGTTTCTT
CTCTCGCCGAGCCACCTCGTCTTCACAACCGGTAACCACTACGTCAAGTTTGTGCACTTGACCCCTGACGTCCAA
GATCTAGAAGTTCCCGAGGACGAGCCTGAAAAGGACGAACGATGTCGAAGCGTCGAGCGCGGCTCTCACTTGGTT
GTCGCCATACCGACCAACATGAGCCTCGTACTGCAAATGCCGAGGGGAAACGTCGAAACCATCTTTCCGCGAGCC
ATGGTCGTCTCCGGGATTCGCGACCTCATCGAGGACAAGAATTACGCCCGGGCCTTTTCCTATTGCCGCACCCAG
CGCGTCGACATGAATATCCTGTACGATCACCGTCCTGCACAGTTCTTGGCCAGCGTGGCGCAATTCCTCGACCAG
CTCGCAGACGTATCGCACATCGATCTGTTCTTGTCGTCTCTTCGTGAGGAGGATGTGACGCAGACCATGTATCAG
GACACGAAGCGGCCATGTCCGCAGGAGTCTCTTGCTCTCCCTGCTGCGATACAGGCTGGCTCCAAGGTGAACACT
GTGTGCGACGCCCTGCTTAAGCGGCTGGAGTCTCGCAAGACCAAGAACCTCCAGAATATCCTGACAGCCCACATG
TGCAAGCTGCCGCCGGCGCTGGACGACGGATTGGCCCTCGTGGCGGAGCTGATGCAGGAGGATGAGAAACTGGCC
GAAAAGGCGATTGAACACGTCTGCTTCCTGGTGGACGTCAATCGCGTGTATGAGAATGCGCTCGGGTTGTACAAC
CTCGACCTCGCGTTGCTGGTTGCACAGCAGTTGCAACGAGATCCACGCGAATATCTTCCCTTTATTCAAAACCTT
CACACTCTGCCTGAACTACGTCGCCGATTCGATATCGATGATCATCTCGGCCGTCGATCCAAGGCTCTCGGGAGC
CTTCAGGCACTCGATGCCTTTGACGAGCTGTGCGACTATGCGACCAAGCATGCCCTGTACCAGGAGGCCCTCAAA
CTCTACCGCTATGAGGCGCCTCGCCTTCAGACTCTAACCCGTCTTTATGCCGCCCACCTCGAATCGCAGTCGGCC
TACCGCGAGGCAGGTCTCGCCTACGAATCCCTCAACGACTATGCCAAAGCGACGAGTTGTTACCGCGCGGCCGGT
GCGACCTGCTGGCAGGAATGTCTCTTCACAGCGCAAATGCAGTCTCCCAGCCTGTCATCCGATGCCATGGTCGAC
CTGGCTACGAGCCTTGCGGATGCTCTCTGGGAAGGCAAAGACTACAGCGCGGCTGCAACCATCCACCTGGATCAC
CTCTCGTCCGTCGAAACCGCCGTCAAGTGCCTCTGCAAGGGGTACATGTTTGCCGAGGCCATCCGACTCGTCGTT
CAGCGAGGCCGCCCGGAGCTCCTTGAGACGACGGTAGACGTCGACCTCGCAGAAGCCCTCGGCAGCACAACCGAG
TTCCTCGCGGACTGCAAAGCTCAGCTCCTCTCCCAGGTGCCCCGGATTGCCGAGCTGCGGCGCAAGGCAGCCGAA
GATCCGCTGAGCTTCTACGAGGGGGACCGCCTCGGCGGGCTCGGCATCCCCGACGATGTCTCTGTCACGGCCAGC
TCGCGGCTGAGTACCAGCGCCAGTCTCTTCACCCGCTATACGGGCACCGTCGGCACCGTCGGAACGGGCGTCAGC
CGAGCGACGAGCAAGAACCGGCGACGCGAAGAGAAGAAGCGCGCGCGAGGTCGAAAAGGGACCGTCTACGAGGAG
GAATATCTCGTCAACAGCGTCCGCCGTCTGGTGGAGCGAGTCGGCACCGCGGCCGCCGAGGTCGAACGGCTGGTC
TTTGCCCTTGTCCGGCGCGGCATGGCGGAGCGCGCGCGCGCTGCTGAGGCGCTCATGGCCGCTGTTGTCGATGCG
TGCCAAGGTGCCGTCGCCAACGTCTTTATAGGCCCTACTAGTACGGACGAGCCGAAGCACAACAACGAGGAGGCG
GACGAATGGAAGGCTACTGGCGGCGACGCAGTGCTGCACGACTGGATGCTCGGCCAGAGCAAGAGGCTGGAGCCT
CCGCTGGTGCCGGCCATGAAGAAGCTGGTTCTCATCGGC
Transcript >Ophio5|1610
ATGCGAAACCTCCGCAACGCCCATTTCGTCCGCCAGACGCTCGCTCGCGCCTCGCCAGACTCTGCGACGGTCTGC
TGGGATCCAGACACGAATGACGTCCTCTCCACTATCGGGCCCACGGCTCAGCGCCCAAAGATAGAGCTTGTCAGA
CTCTCGGACGGCGATTCGCCCCGGACCGTTGCTAGCTGGGACGCACCCAGTCCAAACCCGGACTTGTCTGTGGAT
AGGGTCGTCAGCATTCACCATGTTGGCGGCTCCGCGACGACCTGTCTCGTTCTCGAGGGCGGCGATGTCATCACT
GTCCAGGAGGGGAAGTCCTCTGATGACGCCCGCATCGAGATCGTCGGCTCCATCGACGCCGGCATCGCTGCAGCG
GCCTGGTCTCCCGACGAGGAGGTCCTCGCCATCGTAACCAAGGCCGACACGGTCATCTTCATGACCAGTACCTTT
GATCCCGTCGCTGACGTCGCCCTGAGCTCAGACGATCTGAAAGCCTCCAAACACGTCTCTGTCGGCTGGGGGAAA
AAGGAGACGCAATTCCAGGGCCGGGGAGCCAAGGCCCTGCGAGATCCTACCATACCCGAAAAAGTTGACCAAGGC
TTGCCGAGTCCGCACGAGGACGGCGCCACTGTCATCAGTTGGCGAGGCGACGGTGCCTATGTCGCCGTCAACTCT
TTGCGGCAATCCGACCGCCGAGTTGTTCGCATTTACAATCGACAAGGTGAACTCGAGAGCGCCACTGAGCCTGTC
GATGGCCTGGAAGCTTCTCTCAGCTGGCGGCCGTCGGGAAATTTGCTTGCCGGCATTCAGCGCAAAGCCGATGGC
GTCGACGTCGTTTTCTTCGAGAAGAATGGCCTTCGCCATGGTGATTTTTCTTTACGCTGTCCCGCGGGCGCGACT
ACGTCTAACGCCCTGATCCGACTGCAGTGGAACGCCGACTCGACCGTTCTCGCTGTTATCTTTCGCCATGTGCTG
CAGCTCTGGACCATGGGTAACTATCACTGGTACCTCAAGCAAGAGATTGCTGTGCACGACGGCCTCTCCTGGCTT
GCCTGGCACCCCGAGAAAGCTCTCCTCTTTGCTGCAGTTTCCTCCGGGGCCATCATCACGGCGGAACACATCTTT
AGCACCGCTCGAGGAAGCTGTCGACCTCCTTACGACAACGGCGCGGTGGCGGTCATCGACGGCCAGACTGTCAAG
TTGACTCCCTTCTGTGCTGCCAATGTGCCGCCACCAATGTCTCTTTTTGACGTTAAAGCCGACTCTCCCGTGATA
GACGTAGCCTTTGGTCGCCGCAATGCGTCCTTTGCCGTCTTGCATCGGAACGGTGTCGACATCTACGAGATGCCA
CTGAAAAGCGGACGCCCCGTTCAACCCCAGCTCAAAGCGAAGGTGCCATTTCCTGACGCCCAAGGGCAGAGACTG
ACGCCCTTGCGGCTTTGCTGCGTCGCCATTGACACTTACCGTTGCATTGCCTTTCGAGACGCTCAGGGCTGCTTG
CATTTCGGCCTTAACGCAGAGGCTGGTCGGATGGACCTTTTGGCGGACAAGCGAGATTTGGTATCCACCTCGACG
TTGGATGATGACGCCTCGCTGGAGGGATTCGGACAAGATCTGTCGGGAAACCTCTACAGGTTGTCAGATCCCTCT
TTGGAGCCGTTGTCGATCCGGTTCCCGTCCCATCTTCCTTGGTTTGACATACACAAGTCAGGCGGTGTCATCGTG
GCCTTTGGACTATCGAGAAACGGCCATCTTTACGCCAATCAGAAGTTGCTGGCCAAGAACTGCAACTCGTTTCTT
CTCTCGCCGAGCCACCTCGTCTTCACAACCGGTAACCACTACGTCAAGTTTGTGCACTTGACCCCTGACGTCCAA
GATCTAGAAGTTCCCGAGGACGAGCCTGAAAAGGACGAACGATGTCGAAGCGTCGAGCGCGGCTCTCACTTGGTT
GTCGCCATACCGACCAACATGAGCCTCGTACTGCAAATGCCGAGGGGAAACGTCGAAACCATCTTTCCGCGAGCC
ATGGTCGTCTCCGGGATTCGCGACCTCATCGAGGACAAGAATTACGCCCGGGCCTTTTCCTATTGCCGCACCCAG
CGCGTCGACATGAATATCCTGTACGATCACCGTCCTGCACAGTTCTTGGCCAGCGTGGCGCAATTCCTCGACCAG
CTCGCAGACGTATCGCACATCGATCTGTTCTTGTCGTCTCTTCGTGAGGAGGATGTGACGCAGACCATGTATCAG
GACACGAAGCGGCCATGTCCGCAGGAGTCTCTTGCTCTCCCTGCTGCGATACAGGCTGGCTCCAAGGTGAACACT
GTGTGCGACGCCCTGCTTAAGCGGCTGGAGTCTCGCAAGACCAAGAACCTCCAGAATATCCTGACAGCCCACATG
TGCAAGCTGCCGCCGGCGCTGGACGACGGATTGGCCCTCGTGGCGGAGCTGATGCAGGAGGATGAGAAACTGGCC
GAAAAGGCGATTGAACACGTCTGCTTCCTGGTGGACGTCAATCGCGTGTATGAGAATGCGCTCGGGTTGTACAAC
CTCGACCTCGCGTTGCTGGTTGCACAGCAGTTGCAACGAGATCCACGCGAATATCTTCCCTTTATTCAAAACCTT
CACACTCTGCCTGAACTACGTCGCCGATTCGATATCGATGATCATCTCGGCCGTCGATCCAAGGCTCTCGGGAGC
CTTCAGGCACTCGATGCCTTTGACGAGCTGTGCGACTATGCGACCAAGCATGCCCTGTACCAGGAGGCCCTCAAA
CTCTACCGCTATGAGGCGCCTCGCCTTCAGACTCTAACCCGTCTTTATGCCGCCCACCTCGAATCGCAGTCGGCC
TACCGCGAGGCAGGTCTCGCCTACGAATCCCTCAACGACTATGCCAAAGCGACGAGTTGTTACCGCGCGGCCGGT
GCGACCTGCTGGCAGGAATGTCTCTTCACAGCGCAAATGCAGTCTCCCAGCCTGTCATCCGATGCCATGGTCGAC
CTGGCTACGAGCCTTGCGGATGCTCTCTGGGAAGGCAAAGACTACAGCGCGGCTGCAACCATCCACCTGGATCAC
CTCTCGTCCGTCGAAACCGCCGTCAAGTGCCTCTGCAAGGGGTACATGTTTGCCGAGGCCATCCGACTCGTCGTT
CAGCGAGGCCGCCCGGAGCTCCTTGAGACGACGGTAGACGTCGACCTCGCAGAAGCCCTCGGCAGCACAACCGAG
TTCCTCGCGGACTGCAAAGCTCAGCTCCTCTCCCAGGTGCCCCGGATTGCCGAGCTGCGGCGCAAGGCAGCCGAA
GATCCGCTGAGCTTCTACGAGGGGGACCGCCTCGGCGGGCTCGGCATCCCCGACGATGTCTCTGTCACGGCCAGC
TCGCGGCTGAGTACCAGCGCCAGTCTCTTCACCCGCTATACGGGCACCGTCGGCACCGTCGGAACGGGCGTCAGC
CGAGCGACGAGCAAGAACCGGCGACGCGAAGAGAAGAAGCGCGCGCGAGGTCGAAAAGGGACCGTCTACGAGGAG
GAATATCTCGTCAACAGCGTCCGCCGTCTGGTGGAGCGAGTCGGCACCGCGGCCGCCGAGGTCGAACGGCTGGTC
TTTGCCCTTGTCCGGCGCGGCATGGCGGAGCGCGCGCGCGCTGCTGAGGCGCTCATGGCCGCTGTTGTCGATGCG
TGCCAAGGTGCCGTCGCCAACGTCTTTATAGGCCCTACTAGTACGGACGAGCCGAAGCACAACAACGAGGAGGCG
GACGAATGGAAGGCTACTGGCGGCGACGCAGTGCTGCACGACTGGATGCTCGGCCAGAGCAAGAGGCTGGAGCCT
CCGCTGGTGCCGGCCATGAAGAAGCTGGTTCTCATCGGCTGA
Gene >Ophio5|1610
ATGCGAAACCTCCGCAACGCCCATTTCGTCCGCCAGACGCTCGCTCGCGCCTCGCCAGACTCTGCGACGGTCTGC
TGGGATCCAGACACGAATGACGTCCTCTCCACTATCGGGCCCACGGCTCAGCGCCCAAAGATAGAGCTTGTCAGA
CTCTCGGACGGCGAGTGAGTATACTCTTCCACGTTTCGGATTCGCCGCTGACTGTACCTCGCCCAGTTCGCCCCG
GACCGTTGCTAGCTGGGACGCACCCAGTCCAAACCCGGACTTGTCTGTGGATAGGGTCGTCAGCATTCACCATGT
TGGCGGCTCCGCGACGACCTGTCTCGTTCTCGAGGGCGGCGATGTCATCACTGTCCAGGAGGGGAAGTCCTCTGA
TGACGCCCGCATCGAGATCGTCGGCTCCATCGACGCCGGCATCGCTGCAGCGGCCTGGTCTCCCGACGAGGAGGT
CCTCGCCATCGTAACCAAGGCCGACACGGTCATCTTCATGACCAGTACCTTTGATCCCGTCGCTGACGTCGCCCT
GAGCTCAGACGATCTGAAAGCCTCCAAACACGTCTCTGTCGGCTGGGGGAAAAAGGAGACGCAATTCCAGGGCCG
GGGAGCCAAGGCCCTGCGAGATCCTACCATACCCGAAAAAGTTGACCAAGGCTTGCCGAGTCCGCACGAGGACGG
CGCCACTGTCATCAGTTGGCGAGGCGACGGTGCCTATGTCGCCGTCAACTCTTTGCGGCAATCCGACCGCCGAGT
TGTTCGCATTTACAATCGACAAGGTGAACTCGAGAGCGCCACTGAGCCTGTCGATGGCCTGGAAGCTTCTCTCAG
CTGGCGGCCGTCGGGAAATTTGCTTGCCGGCATTCAGCGCAAAGCCGATGGCGTCGACGTCGTTTTCTTCGAGAA
GAATGGCCTTCGCCATGGTGATTTTTCTTTACGCTGTCCCGCGGGCGCGACTACGTCTAACGCCCTGATCCGACT
GCAGTGGAACGCCGACTCGACCGTTCTCGCTGTTATCTTTCGCCATGTGCTGCAGCTCTGGACCATGGGTAACTA
TCACTGGTACCTCAAGCAAGAGATTGCTGTGCACGACGGCCTCTCCTGGCTTGCCTGGCACCCCGAGAAAGCTCT
CCTCTTTGCTGCAGTTTCCTCCGGGGCCATCATCACGGCGGAACACATCTTTAGCACCGCTCGAGGAAGCTGTCG
ACCTCCTTACGACAACGGCGCGGTGGCGGTCATCGACGGCCAGACTGTCAAGTTGACTCCCTTCTGTGCTGCCAA
TGTGCCGCCACCAATGTCTCTTTTTGACGTTAAAGCCGACTCTCCCGTGATAGACGTAGCCTTTGGTCGCCGCAA
TGCGTCCTTTGCCGTCTTGCATCGGAACGGTGTCGACATCTACGAGATGCCACTGAAAAGCGGACGCCCCGTTCA
ACCCCAGCTCAAAGCGAAGGTGCCATTTCCTGACGCCCAAGGGCAGAGACTGACGCCCTTGCGGCTTTGCTGCGT
CGCCATTGACACTTACCGTTGCATTGCCTTTCGAGACGCTCAGGGCTGCTTGCATTTCGGCCTTAACGCAGAGGC
TGGTCGGATGGACCTTTTGGCGGACAAGCGAGATTTGGTATCCACCTCGACGTTGGATGATGACGCCTCGCTGGA
GGGATTCGGACAAGATCTGTCGGGAAACCTCTACAGGTTGTCAGATCCCTCTTTGGAGCCGTTGTCGATCCGGTT
CCCGTCCCATCTTCCTTGGTTTGACATACACAAGTCAGGCGGTGTCATCGTGGCCTTTGGACTATCGAGAAACGG
CCATCTTTACGCCAATCAGAAGTTGCTGGCCAAGAACTGCAACTCGTTTCTTCTCTCGCCGAGCCACCTCGTCTT
CACAACCGGTAACCACTACGTCAAGTTTGTGCACTTGACCCCTGACGTCCAAGGTGCCGTTCCCTTGGTCAAAAC
AATGACATTCGGCCCCTCCCACTGACTTGTTTGCCAGATCTAGAAGTTCCCGAGGACGAGCCTGAAAAGGACGAA
CGATGTCGAAGCGTCGAGCGCGGCTCTCACTTGGTTGTCGCCATACCGACCAACATGAGCCTCGTACTGCAAATG
CCGAGGGGAAACGTCGAAACCATCTTTCCGCGAGCCATGGTCGTCTCCGGGATTCGCGACCTCATCGAGGACAAG
AATTACGCCCGGGCCTTTTCCTATTGCCGCACCCAGCGCGTCGACATGAATATCCTGTACGATCACCGTCCTGCA
CAGTTCTTGGCCAGCGTGGCGCAATTCCTCGACCAGCTCGCAGACGTATCGCACATCGATCTGTTCTTGTCGTCT
CTTCGGTGAGGCTCTCCTTTATCACCATTGCGTCGCTCACCGCATTGACGAGAAGACAGTGAGGAGGATGTGACG
CAGACCATGTATCAGGACACGAAGCGGCCATGTCCGCAGGAGTCTCTTGCTCTCCCTGCTGCGATACAGGCTGGC
TCCAAGGTGAACACTGTGTGCGACGCCCTGCTTAAGCGGCTGGAGTCTCGCAAGACCAAGAACCTCCAGAATATC
CTGACAGCCCACATGTGCAAGCTGCCGCCGGCGCTGGACGACGGATTGGCCCTCGTGGCGGAGCTGATGCAGGAG
GATGAGAAACTGGCCGAAAAGGCGATTGAACACGTCTGCTTCCTGGTGGACGTCAATCGCGTGTATGAGAATGCG
CTCGGGTTGTACAACCTCGACCTCGCGTTGCTGGTTGCACAGCAGTTGCAACGAGATCCACGCGAATATCTTCCC
TTTATTCAAAACCTTCACACTCTGCCTGAACTACGTCGCCGATTCGATATCGATGATCATCTCGGCCGTCGATCC
AAGGCTCTCGGGAGCCTTCAGGCACTCGATGCCTTTGACGAGCTGTGCGACTATGCGACCAAGCATGCCCTGTAC
CAGGAGGCCCTCAAACTCTACCGCTATGAGGCGCCTCGCCTTCAGACTCTAACCCGTCTTTATGCCGCCCACCTC
GAATCGCAGTCGGCCTACCGCGAGGCAGGTCTCGCCTACGAATCCCTCAACGACTATGCCAAAGCGACGAGTTGT
TACCGCGCGGCCGGTGCGACCTGCTGGCAGGAATGTCTCTTCACAGCGCAAATGCAGTCTCCCAGCCTGTCATCC
GATGCCATGGTCGACCTGGCTACGAGCCTTGCGGATGCTCTCTGGGAAGGCAAAGACTACAGCGCGGCTGCAACC
ATCCACCTGGATCACCTCTCGTCCGTCGAAACCGCCGTCAAGTGCCTCTGCAAGGGGTACATGTTTGCCGAGGCC
ATCCGACTCGTCGTTCAGCGAGGCCGCCCGGAGCTCCTTGAGACGACGGTAGACGTCGACCTCGCAGAAGCCCTC
GGCAGCACAACCGAGTTCCTCGCGGACTGCAAAGCTCAGCTCCTCTCCCAGGTGCCCCGGATTGCCGAGCTGCGG
CGCAAGGCAGCCGAAGATCCGCTGAGCTTCTACGAGGGGGACCGCCTCGGCGGGCTCGGCATCCCCGACGATGTC
TCTGTCACGGCCAGCTCGCGGCTGAGTACCAGCGCCAGTCTCTTCACCCGCTATACGGGCACCGTCGGCACCGTC
GGAACGGGCGTCAGCCGAGCGACGAGCAAGAACCGGCGACGCGAAGAGAAGAAGCGCGCGCGAGGTCGAAAAGGG
ACCGTCTACGAGGAGGAATATCTCGTCAACAGCGTCCGCCGTCTGGTGGAGCGAGTCGGCACCGCGGCCGCCGAG
GTCGAACGGCTGGTCTTTGCCCTTGTCCGGCGCGGCATGGCGGAGCGCGCGCGCGCTGCTGAGGCGCTCATGGCC
GCTGTTGTCGATGCGTGCCAAGGTGCCGTCGCCAACGTCTTTATAGGCCCTACTAGTACGGACGAGCCGAAGCAC
AACAACGAGGAGGCGGACGAATGGAAGGCTACTGGCGGCGACGCAGTGCTGCACGACTGGATGCTCGGCCAGAGC
AAGAGGCTGGAGCCTCCGCTGGTGCCGGCCATGAAGAAGCTGGTTCTCATCGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail