Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1608
Gene name
Locationscaffold_159:13400..15309
Strand-
Gene length (bp)1909
Transcript length (bp)1623
Coding sequence length (bp)1620
Protein length (aa) 540

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 6.5E-115 75 530
PF07690 MFS_1 Major Facilitator Superfamily 5.2E-26 80 407

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 52 538 2.0E-116
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 11 536 2.0E-116
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 7 538 2.0E-108
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 35 538 5.0E-107
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 70 537 3.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 52 538 2.0E-116
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 11 536 2.0E-116
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 7 538 2.0E-108
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 35 538 5.0E-107
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 70 537 3.0E-75
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 80 527 4.0E-75
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 80 539 2.0E-65
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 60 533 4.0E-64
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 78 535 1.0E-63
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 78 535 1.0E-63
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 59 533 3.0E-63
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 72 535 4.0E-62
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 74 535 3.0E-61
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 74 535 3.0E-61
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 70 534 1.0E-60
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 85 532 6.0E-60
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 73 538 2.0E-59
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 70 532 3.0E-59
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 70 431 7.0E-59
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 70 412 1.0E-58
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 73 532 1.0E-58
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 71 536 1.0E-58
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 70 404 5.0E-57
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 53 411 8.0E-57
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 70 527 5.0E-53
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 70 533 6.0E-53
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 70 533 6.0E-53
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 37 535 2.0E-52
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 75 533 2.0E-52
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 70 536 1.0E-51
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 53 411 2.0E-51
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 73 533 2.0E-51
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 53 411 3.0E-51
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 78 527 6.0E-51
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 71 534 6.0E-51
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 56 536 1.0E-50
sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 108 527 5.0E-50
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 70 531 7.0E-50
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 69 527 9.0E-50
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 80 527 3.0E-49
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 65 533 3.0E-49
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 78 534 4.0E-49
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 36 535 5.0E-49
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 64 536 7.0E-49
sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14 PE=2 SV=1 73 535 1.0E-48
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 70 536 2.0E-48
sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1 73 535 2.0E-48
sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus GN=SLC2A3 PE=2 SV=1 65 533 2.0E-48
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 80 530 2.0E-48
sp|Q8IRI6|GTR1_DROME Glucose transporter type 1 OS=Drosophila melanogaster GN=Glut1 PE=2 SV=4 67 537 3.0E-48
sp|Q5R608|GTR3_PONAB Solute carrier family 2, facilitated glucose transporter member 3 OS=Pongo abelii GN=SLC2A3 PE=2 SV=1 73 535 3.0E-48
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 67 530 9.0E-48
sp|O65413|STP12_ARATH Sugar transport protein 12 OS=Arabidopsis thaliana GN=STP12 PE=2 SV=1 69 536 1.0E-47
sp|Q27994|GTR4_BOVIN Solute carrier family 2, facilitated glucose transporter member 4 OS=Bos taurus GN=SLC2A4 PE=2 SV=2 47 534 1.0E-47
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 86 527 2.0E-47
sp|Q9SCW7|ERDL1_ARATH Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2 108 527 6.0E-47
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2 76 527 6.0E-47
sp|Q90592|GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus GN=SLC2A2 PE=2 SV=1 119 527 1.0E-46
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 76 535 1.0E-46
sp|A9ZSY2|TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica GN=Tret1 PE=1 SV=1 42 527 2.0E-46
sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 108 532 2.0E-46
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 36 535 3.0E-46
sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 52 534 4.0E-46
sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 108 532 6.0E-46
sp|P58351|GTR2_BOVIN Solute carrier family 2, facilitated glucose transporter member 2 OS=Bos taurus GN=SLC2A2 PE=2 SV=2 102 495 6.0E-46
sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1 108 537 9.0E-46
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 76 527 9.0E-46
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 36 535 9.0E-46
sp|P15729|GLCP_SYNY3 Glucose transport protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gtr PE=3 SV=2 70 527 1.0E-45
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 36 535 2.0E-45
sp|Q8L6Z8|XYLL1_ARATH D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1 83 527 2.0E-45
sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 75 527 6.0E-45
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus GN=Slc2a3 PE=1 SV=1 71 533 6.0E-45
sp|Q8VZT3|EDL12_ARATH Sugar transporter ERD6-like 12 OS=Arabidopsis thaliana GN=SUGTL5 PE=2 SV=1 85 527 1.0E-44
sp|P21906|GLF_ZYMMO Glucose facilitated diffusion protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glf PE=3 SV=2 64 527 3.0E-44
sp|P20303|GTR1_PIG Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa GN=SLC2A1 PE=2 SV=2 74 535 5.0E-44
sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1 76 527 5.0E-44
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 86 527 6.0E-44
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 31 535 7.0E-44
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 70 527 9.0E-44
sp|P14672|GTR4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens GN=SLC2A4 PE=1 SV=1 47 534 1.0E-43
sp|Q9FMX3|STP11_ARATH Sugar transport protein 11 OS=Arabidopsis thaliana GN=STP11 PE=1 SV=1 70 527 1.0E-43
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 69 535 2.0E-43
sp|P15686|HUP1_PARKE H(+)/hexose cotransporter 1 OS=Parachlorella kessleri GN=HUP1 PE=2 SV=2 66 536 2.0E-43
sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 52 527 3.0E-43
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 69 533 3.0E-43
sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 69 533 4.0E-43
sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2 74 535 4.0E-43
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 74 535 6.0E-43
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 67 540 8.0E-43
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 71 533 1.0E-42
sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 61 527 1.0E-42
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 70 536 1.0E-42
sp|P11167|GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus GN=Slc2a1 PE=1 SV=1 74 535 1.0E-42
sp|P19357|GTR4_RAT Solute carrier family 2, facilitated glucose transporter member 4 OS=Rattus norvegicus GN=Slc2a4 PE=1 SV=1 47 534 1.0E-42
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 108 527 1.0E-42
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 70 530 2.0E-42
sp|Q9M0Z9|EDL15_ARATH Sugar transporter ERD6-like 15 OS=Arabidopsis thaliana GN=At4g04760 PE=3 SV=2 82 532 2.0E-42
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 27 535 2.0E-42
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 27 535 2.0E-42
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 27 535 3.0E-42
sp|P27674|GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus GN=SLC2A1 PE=1 SV=1 74 535 3.0E-42
sp|Q9JIF3|GTR8_MOUSE Solute carrier family 2, facilitated glucose transporter member 8 OS=Mus musculus GN=Slc2a8 PE=1 SV=2 134 533 3.0E-42
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3 63 527 4.0E-42
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 59 535 4.0E-42
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 52 527 4.0E-42
sp|Q39524|HUP2_PARKE H(+)/hexose cotransporter 2 OS=Parachlorella kessleri GN=HUP2 PE=2 SV=1 69 540 4.0E-42
sp|P13355|GTR1_RABIT Solute carrier family 2, facilitated glucose transporter member 1 OS=Oryctolagus cuniculus GN=SLC2A1 PE=2 SV=1 74 535 4.0E-42
sp|P17809|GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus GN=Slc2a1 PE=1 SV=4 74 535 5.0E-42
sp|Q9JJZ1|GTR8_RAT Solute carrier family 2, facilitated glucose transporter member 8 OS=Rattus norvegicus GN=Slc2a8 PE=1 SV=1 75 533 8.0E-42
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 28 535 9.0E-42
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 76 536 1.0E-41
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 59 535 1.0E-41
sp|Q9NY64|GTR8_HUMAN Solute carrier family 2, facilitated glucose transporter member 8 OS=Homo sapiens GN=SLC2A8 PE=1 SV=3 83 533 1.0E-41
sp|P14142|GTR4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus GN=Slc2a4 PE=1 SV=3 47 534 2.0E-41
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 86 534 3.0E-41
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 43 535 4.0E-41
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 85 534 1.0E-39
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 85 527 1.0E-39
sp|P58354|GTR8_BOVIN Solute carrier family 2, facilitated glucose transporter member 8 OS=Bos taurus GN=SLC2A8 PE=2 SV=2 83 533 2.0E-39
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 70 527 5.0E-39
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 70 527 6.0E-39
sp|Q9XSC2|GTR3_RABIT Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Oryctolagus cuniculus GN=SLC2A3 PE=2 SV=1 162 533 7.0E-39
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 13 527 7.0E-39
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 52 527 1.0E-38
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 52 527 1.0E-38
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 43 534 1.0E-38
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 18 535 2.0E-38
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 71 531 3.0E-38
sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 52 527 3.0E-38
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 139 527 5.0E-38
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 74 527 6.0E-38
sp|Q9SFG0|STP6_ARATH Sugar transport protein 6 OS=Arabidopsis thaliana GN=STP6 PE=1 SV=1 69 527 7.0E-38
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 52 527 7.0E-38
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 52 527 8.0E-38
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 70 527 1.0E-37
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 52 527 1.0E-37
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 134 527 3.0E-37
sp|P79365|GTR1_SHEEP Solute carrier family 2, facilitated glucose transporter member 1 (Fragment) OS=Ovis aries GN=SLC2A1 PE=2 SV=1 162 535 4.0E-37
sp|Q94KE0|ERDL3_ARATH Sugar transporter ERD6-like 3 OS=Arabidopsis thaliana GN=SUGTL2 PE=2 SV=1 103 527 5.0E-37
sp|O44616|FGTH1_CAEEL Facilitated glucose transporter homolog OS=Caenorhabditis elegans GN=R09B5.11 PE=1 SV=2 119 524 8.0E-37
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 61 535 9.0E-37
sp|Q9SBA7|STP8_ARATH Sugar transport protein 8 OS=Arabidopsis thaliana GN=STP8 PE=2 SV=2 55 527 1.0E-36
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 56 532 1.0E-36
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 56 532 2.0E-36
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 321 538 2.0E-36
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 39 535 5.0E-36
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 76 536 5.0E-36
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 24 535 9.0E-36
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 68 531 1.0E-35
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 70 531 2.0E-35
sp|P38142|YB91_YEAST Probable metabolite transport protein YBR241C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR241C PE=1 SV=1 108 522 2.0E-35
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 71 533 2.0E-35
sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 52 527 3.0E-35
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 134 535 3.0E-35
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 59 535 5.0E-35
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 76 536 6.0E-35
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 80 531 1.0E-34
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 134 535 1.0E-34
sp|Q32NG5|GTR12_XENLA Solute carrier family 2, facilitated glucose transporter member 12 OS=Xenopus laevis GN=slc2a12 PE=2 SV=1 51 419 1.0E-34
sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 52 527 1.0E-34
sp|Q9BE72|GTR12_MACFA Solute carrier family 2, facilitated glucose transporter member 12 OS=Macaca fascicularis GN=SLC2A12 PE=2 SV=1 27 393 2.0E-34
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 78 300 3.0E-34
sp|Q8BFW9|GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus GN=Slc2a12 PE=2 SV=1 27 393 2.0E-33
sp|Q9LTP6|EDL13_ARATH Putative sugar transporter ERD6-like 13 OS=Arabidopsis thaliana GN=At3g20460 PE=3 SV=2 125 527 2.0E-33
sp|Q8TD20|GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens GN=SLC2A12 PE=2 SV=1 27 393 2.0E-33
sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 52 527 2.0E-33
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 74 533 2.0E-33
sp|Q4U3U6|QAY_NEUAF Quinate permease OS=Neurospora africana GN=qa-y PE=3 SV=1 78 532 3.0E-33
sp|Q8L7R8|STP3_ARATH Sugar transport protein 3 OS=Arabidopsis thaliana GN=STP3 PE=2 SV=2 53 536 3.0E-33
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 78 533 4.0E-33
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus GN=Slc2a5 PE=1 SV=2 114 532 5.0E-33
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus GN=Slc2a5 PE=1 SV=1 64 532 6.0E-33
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 70 536 8.0E-33
sp|Q5J316|GTR12_BOVIN Solute carrier family 2, facilitated glucose transporter member 12 OS=Bos taurus GN=SLC2A12 PE=1 SV=1 27 393 1.0E-32
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 78 533 2.0E-32
sp|O95528|GTR10_HUMAN Solute carrier family 2, facilitated glucose transporter member 10 OS=Homo sapiens GN=SLC2A10 PE=1 SV=2 80 527 3.0E-32
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 186 535 3.0E-32
sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT14 PE=1 SV=2 74 533 4.0E-32
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 71 533 4.0E-32
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 80 535 1.0E-31
sp|Q5RET7|GTR5_PONAB Solute carrier family 2, facilitated glucose transporter member 5 OS=Pongo abelii GN=SLC2A5 PE=2 SV=1 100 532 1.0E-31
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 81 530 2.0E-31
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 12 532 2.0E-31
sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2 81 530 3.0E-31
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 80 535 3.0E-31
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 74 531 4.0E-31
sp|Q10710|STA_RICCO Sugar carrier protein A OS=Ricinus communis GN=STA PE=2 SV=1 76 536 5.0E-31
sp|P0C6A1|GTR7_MOUSE Solute carrier family 2, facilitated glucose transporter member 7 OS=Mus musculus GN=Slc2a7 PE=3 SV=1 67 538 1.0E-30
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 80 534 2.0E-30
sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose transporter member 7 OS=Rattus norvegicus GN=Slc2a7 PE=2 SV=1 56 532 6.0E-30
sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2 56 532 6.0E-30
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 71 533 6.0E-30
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 71 533 6.0E-30
sp|Q9P3U6|GHT1_SCHPO High-affinity glucose transporter ght1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght1 PE=1 SV=1 74 531 1.0E-29
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 71 533 1.0E-29
sp|Q9UGQ3|GTR6_HUMAN Solute carrier family 2, facilitated glucose transporter member 6 OS=Homo sapiens GN=SLC2A6 PE=1 SV=2 75 535 6.0E-29
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 71 534 8.0E-29
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 109 531 9.0E-29
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 71 534 1.0E-28
sp|Q7XA64|ERDL9_ARATH Sugar transporter ERD6-like 9 OS=Arabidopsis thaliana GN=At3g05155 PE=2 SV=1 69 394 2.0E-28
sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus laevis GN=slc2a10 PE=2 SV=1 80 394 3.0E-28
sp|Q0P4G6|GTR10_XENTR Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus tropicalis GN=slc2a10 PE=2 SV=1 74 394 1.0E-27
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 71 533 1.0E-27
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 71 533 4.0E-27
sp|P22732|GTR5_HUMAN Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens GN=SLC2A5 PE=1 SV=1 100 532 8.0E-26
sp|Q863Y9|GTR5_HORSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Equus caballus GN=SLC2A5 PE=2 SV=1 134 532 2.0E-24
sp|Q6NWF1|GTR12_DANRE Solute carrier family 2, facilitated glucose transporter member 12 OS=Danio rerio GN=slc2a12 PE=2 SV=2 27 393 4.0E-24
sp|P53142|VPS73_YEAST Vacuolar protein sorting-associated protein 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS73 PE=1 SV=1 107 521 1.0E-23
sp|Q9BYW1|GTR11_HUMAN Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens GN=SLC2A11 PE=2 SV=1 77 534 2.0E-23
sp|P46408|GTR5_RABIT Solute carrier family 2, facilitated glucose transporter member 5 OS=Oryctolagus cuniculus GN=SLC2A5 PE=2 SV=1 134 527 6.0E-22
sp|Q8VHD6|GTR10_MOUSE Solute carrier family 2, facilitated glucose transporter member 10 OS=Mus musculus GN=Slc2a10 PE=2 SV=1 74 402 1.0E-19
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 312 535 4.0E-19
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 425 536 2.0E-18
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 76 277 3.0E-18
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 76 277 1.0E-17
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 134 533 2.0E-17
sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL040W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL040W PE=1 SV=1 98 533 3.0E-17
sp|P53403|GTR3_DROME Glucose transporter type 3 OS=Drosophila melanogaster GN=Glut3 PE=2 SV=1 46 482 3.0E-17
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 425 536 5.0E-17
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 83 292 6.0E-16
sp|P15685|MAL61_YEASX Maltose permease MAL61 OS=Saccharomyces cerevisiae GN=MAL61 PE=3 SV=1 136 535 7.0E-16
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 312 535 3.0E-15
sp|Q46909|YGCS_ECOLI Inner membrane metabolite transport protein YgcS OS=Escherichia coli (strain K12) GN=ygcS PE=1 SV=2 71 306 4.0E-15
sp|P38156|MAL31_YEAST Maltose permease MAL31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL31 PE=1 SV=1 136 535 1.0E-14
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 439 534 9.0E-14
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 125 539 9.0E-14
sp|C8Z6M6|MPH3_YEAS8 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MPH3 PE=3 SV=1 136 535 3.0E-13
sp|P0CD99|MPH2_YEAST Alpha-glucosides permease MPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH2 PE=2 SV=1 136 535 3.0E-13
sp|P0CE00|MPH3_YEAST Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH3 PE=1 SV=1 136 535 3.0E-13
sp|A6ZX88|MPH3_YEAS7 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MPH3 PE=3 SV=1 136 535 3.0E-13
sp|B5VF36|MPH3_YEAS6 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MPH3 PE=3 SV=1 136 535 3.0E-13
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 434 534 6.0E-13
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 434 534 7.0E-13
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 310 535 1.0E-12
sp|Q9WTN6|S22AL_MOUSE Solute carrier family 22 member 21 OS=Mus musculus GN=Slc22a21 PE=2 SV=1 87 534 2.0E-12
sp|Q5J316|GTR12_BOVIN Solute carrier family 2, facilitated glucose transporter member 12 OS=Bos taurus GN=SLC2A12 PE=1 SV=1 432 529 3.0E-12
sp|Q8VHD6|GTR10_MOUSE Solute carrier family 2, facilitated glucose transporter member 10 OS=Mus musculus GN=Slc2a10 PE=2 SV=1 434 527 4.0E-12
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 434 534 5.0E-12
sp|Q8BFW9|GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus GN=Slc2a12 PE=2 SV=1 432 527 6.0E-12
sp|Q9BE72|GTR12_MACFA Solute carrier family 2, facilitated glucose transporter member 12 OS=Macaca fascicularis GN=SLC2A12 PE=2 SV=1 432 529 8.0E-12
sp|Q8TD20|GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens GN=SLC2A12 PE=2 SV=1 432 529 8.0E-12
sp|Q32NG5|GTR12_XENLA Solute carrier family 2, facilitated glucose transporter member 12 OS=Xenopus laevis GN=slc2a12 PE=2 SV=1 432 534 2.0E-11
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 17 283 2.0E-11
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 17 283 2.0E-11
sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus laevis GN=slc2a10 PE=2 SV=1 432 527 3.0E-11
sp|Q0P4G6|GTR10_XENTR Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus tropicalis GN=slc2a10 PE=2 SV=1 432 527 3.0E-11
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 108 540 3.0E-11
sp|Q9ZWT3|PHT16_ARATH Probable inorganic phosphate transporter 1-6 OS=Arabidopsis thaliana GN=PHT1-6 PE=1 SV=1 80 527 6.0E-11
sp|Q8CFZ5|S22AC_MOUSE Solute carrier family 22 member 12 OS=Mus musculus GN=Slc22a12 PE=1 SV=1 87 471 1.0E-10
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 108 540 2.0E-10
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 108 540 2.0E-10
sp|Q5EXK5|MHBT_KLEOX 3-hydroxybenzoate transporter MhbT OS=Klebsiella oxytoca GN=mhbT PE=1 SV=1 134 263 2.0E-10
sp|Q1LVS8|SVOPL_DANRE Putative transporter SVOPL OS=Danio rerio GN=svopl PE=2 SV=1 114 304 3.0E-10
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 17 283 4.0E-10
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 108 540 4.0E-10
sp|Q9Z0E8|S22A5_MOUSE Solute carrier family 22 member 5 OS=Mus musculus GN=Slc22a5 PE=1 SV=1 63 276 1.0E-09
sp|O76082|S22A5_HUMAN Solute carrier family 22 member 5 OS=Homo sapiens GN=SLC22A5 PE=1 SV=1 97 309 1.0E-09
sp|O62787|GTR3_PIG Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Sus scrofa GN=SLC2A3 PE=2 SV=1 171 262 2.0E-09
sp|P76230|YDJK_ECOLI Putative metabolite transport protein YdjK OS=Escherichia coli (strain K12) GN=ydjK PE=3 SV=1 117 284 2.0E-09
sp|O70594|S22A5_RAT Solute carrier family 22 member 5 OS=Rattus norvegicus GN=Slc22a5 PE=1 SV=1 115 313 2.0E-09
sp|Q8H074|PT112_ORYSJ Probable inorganic phosphate transporter 1-12 OS=Oryza sativa subsp. japonica GN=PHT1-12 PE=2 SV=1 134 527 2.0E-09
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 107 298 2.0E-09
sp|Q9XT10|GTR4_PIG Solute carrier family 2, facilitated glucose transporter member 4 (Fragment) OS=Sus scrofa GN=SLC2A4 PE=2 SV=1 76 207 3.0E-09
sp|Q69ZS6|SV2C_MOUSE Synaptic vesicle glycoprotein 2C OS=Mus musculus GN=Sv2c PE=1 SV=2 29 283 4.0E-09
sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo sapiens GN=SV2C PE=1 SV=1 29 283 5.0E-09
sp|Q9Z2I6|SV2C_RAT Synaptic vesicle glycoprotein 2C OS=Rattus norvegicus GN=Sv2c PE=1 SV=1 29 283 5.0E-09
sp|Q27115|HT1_TRYVI Glucose transporter HT1 OS=Trypanosoma vivax GN=HT1 PE=3 SV=1 109 494 8.0E-09
sp|Q9U539|OCT1_CAEEL Organic cation transporter 1 OS=Caenorhabditis elegans GN=oct-1 PE=1 SV=3 117 313 3.0E-08
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 111 307 3.0E-08
sp|Q940M4|OCT7_ARATH Organic cation/carnitine transporter 7 OS=Arabidopsis thaliana GN=OCT7 PE=2 SV=1 108 335 3.0E-08
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 108 540 4.0E-08
sp|O15244|S22A2_HUMAN Solute carrier family 22 member 2 OS=Homo sapiens GN=SLC22A2 PE=1 SV=2 114 473 9.0E-08
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 32 283 9.0E-08
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 32 283 1.0E-07
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 32 283 1.0E-07
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 108 540 1.0E-07
sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 32 283 1.0E-07
sp|Q9XST2|GTR4_CANLF Solute carrier family 2, facilitated glucose transporter member 4 (Fragment) OS=Canis lupus familiaris GN=SLC2A4 PE=2 SV=1 352 495 1.0E-07
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 108 283 1.0E-07
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 44 283 1.0E-07
sp|Q09037|TH12_TRYBB Glucose transporter 1E OS=Trypanosoma brucei brucei GN=THT1E PE=2 SV=1 98 494 1.0E-07
sp|O51798|MMLH_CUPPJ Probable 4-methylmuconolactone transporter OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=mmlH PE=3 SV=1 131 527 2.0E-07
sp|Q9R1U7|S22A8_RAT Solute carrier family 22 member 8 OS=Rattus norvegicus GN=Slc22a8 PE=1 SV=1 88 306 3.0E-07
sp|Q8HY24|S22A8_RABIT Solute carrier family 22 member 8 OS=Oryctolagus cuniculus GN=SLC22A8 PE=2 SV=1 104 277 3.0E-07
sp|Q1RPP5|S22A7_PIG Solute carrier family 22 member 7 OS=Sus scrofa GN=SLC22A7 PE=2 SV=1 134 412 3.0E-07
sp|Q91WU2|S22A7_MOUSE Solute carrier family 22 member 7 OS=Mus musculus GN=Slc22a7 PE=1 SV=1 134 304 4.0E-07
sp|Q8N434|SVOPL_HUMAN Putative transporter SVOPL OS=Homo sapiens GN=SVOPL PE=2 SV=2 46 277 5.0E-07
sp|Q6NWF1|GTR12_DANRE Solute carrier family 2, facilitated glucose transporter member 12 OS=Danio rerio GN=slc2a12 PE=2 SV=2 434 532 7.0E-07
sp|Q3ZAV1|S22AC_RAT Solute carrier family 22 member 12 OS=Rattus norvegicus GN=Slc22a12 PE=2 SV=1 87 307 7.0E-07
sp|Q9H015|S22A4_HUMAN Solute carrier family 22 member 4 OS=Homo sapiens GN=SLC22A4 PE=1 SV=3 97 303 8.0E-07
sp|Q4W8A2|S22A8_MACFA Solute carrier family 22 member 8 OS=Macaca fascicularis GN=SLC22A8 PE=2 SV=1 88 299 1.0E-06
sp|Q8IZD6|S22AF_HUMAN Solute carrier family 22 member 15 OS=Homo sapiens GN=SLC22A15 PE=2 SV=1 134 271 1.0E-06
sp|Q8MJI6|S22A2_RABIT Solute carrier family 22 member 2 OS=Oryctolagus cuniculus GN=SLC22A2 PE=1 SV=1 114 534 1.0E-06
sp|Q7RVX9|PHO5_NEUCR Repressible high-affinity phosphate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-5 PE=1 SV=2 135 481 2.0E-06
sp|Q5RLM2|S22A7_RAT Solute carrier family 22 member 7 OS=Rattus norvegicus GN=Slc22a7 PE=1 SV=1 81 271 2.0E-06
sp|A9CB25|S22A4_PAPAN Solute carrier family 22 member 4 OS=Papio anubis GN=SLC22A4 PE=3 SV=1 101 303 2.0E-06
sp|P53048|MAL11_YEAST General alpha-glucoside permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL11 PE=1 SV=1 37 397 2.0E-06
sp|Q9Y226|S22AD_HUMAN Solute carrier family 22 member 13 OS=Homo sapiens GN=SLC22A13 PE=2 SV=2 102 535 3.0E-06
sp|O30513|BENK_ACIAD Benzoate transport protein OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=benK PE=3 SV=2 119 304 4.0E-06
sp|A6QLW8|S22A7_BOVIN Solute carrier family 22 member 7 OS=Bos taurus GN=SLC22A7 PE=2 SV=1 125 297 4.0E-06
sp|Q9Z306|S22A4_MOUSE Solute carrier family 22 member 4 OS=Mus musculus GN=Slc22a4 PE=1 SV=1 63 276 4.0E-06
sp|Q5R9C4|S22A8_PONAB Solute carrier family 22 member 8 OS=Pongo abelii GN=SLC22A8 PE=2 SV=1 88 299 4.0E-06
sp|A8GHR1|MDTD_SERP5 Putative multidrug resistance protein MdtD OS=Serratia proteamaculans (strain 568) GN=mdtD PE=3 SV=1 85 256 4.0E-06
sp|Q7Z118|YMPB_CAEEL Putative transporter B0361.11 OS=Caenorhabditis elegans GN=B0361.11 PE=3 SV=2 124 466 5.0E-06
sp|Q9R141|S22A4_RAT Solute carrier family 22 member 4 OS=Rattus norvegicus GN=Slc22a4 PE=1 SV=1 113 306 6.0E-06
sp|Q504N2|S22AF_MOUSE Solute carrier family 22 member 15 OS=Mus musculus GN=Slc22a15 PE=2 SV=3 134 271 6.0E-06
sp|Q3YAW7|S22A7_RABIT Solute carrier family 22 member 7 OS=Oryctolagus cuniculus GN=SLC22A7 PE=2 SV=1 134 298 7.0E-06
sp|Q6DFR1|S22AF_XENTR Solute carrier family 22 member 15 OS=Xenopus tropicalis GN=slc22a15 PE=2 SV=2 134 271 7.0E-06
sp|Q8TCC7|S22A8_HUMAN Solute carrier family 22 member 8 OS=Homo sapiens GN=SLC22A8 PE=1 SV=1 88 299 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 78 100 22
2 115 134 19
3 143 162 19
4 167 189 22
5 201 223 22
6 233 255 22
7 340 359 19
8 363 385 22
9 392 414 22
10 432 454 22
11 466 488 22
12 492 514 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1608
MRPCNPHPAQFTHGRRPHPALPTQAIMDSPRAPLMADHDGLADEVEPTAFHSEAAPRGPVKPVETGPGIFVQALT
LAAGISGLLFGYDTGVISATLVSIGTSLSNRPLTSMDKSMITSSVALFALITSSLSSILADKFGRKRVILYADVL
FVAGALVQAFCSTVPLMVAGRCIVGAGVGAASFVVPLYIAEVAPASHRGKLVTTNVLFITLGQMVAYIVGWLLST
YTAKETGWRWMVGLGAMPAALQGAIIVLMPETPRWLVKVGRLAEARLVMRRVEPGSTRDADAVVAEMEAEVREER
ESRRKRGHGAWGLAWRELLGEARNRRALALACLLQGLQQLCGFNSLMYYSATIFALVGFVSPTLTALTVAVTNFV
LTLAALGLIDRVGRRRILLWSMPGMVLGLVAAAAGFSILPLDATAVGEADDGGPARLILASIMVYVAAYALGLGN
VPWMQSELFPLTVRSVGSGVATATNWTANLIVGLTFLPMMEALSPAWTMATYAAVCCVGYVLVWRIYPETAGLSL
EEATSLLEHGWGVGR
Coding >Ophio5|1608
ATGCGCCCCTGCAATCCACACCCGGCCCAATTCACTCATGGCAGGAGGCCTCATCCGGCACTCCCAACCCAAGCC
ATCATGGACAGCCCCCGAGCGCCGTTGATGGCTGACCACGACGGTCTGGCCGATGAAGTCGAGCCGACCGCCTTC
CACAGCGAGGCCGCCCCGCGCGGGCCGGTAAAGCCGGTCGAGACGGGTCCTGGCATCTTCGTCCAGGCGCTGACC
TTGGCGGCGGGCATCAGCGGCCTCCTTTTTGGATACGACACGGGCGTCATATCGGCGACTCTCGTTTCAATAGGA
ACTTCGCTCTCGAACCGACCACTGACGTCCATGGACAAGTCCATGATTACGTCGTCCGTGGCGCTCTTTGCCCTC
ATCACGTCTTCCTTGTCCTCGATTCTCGCTGATAAGTTCGGTCGTAAACGCGTCATTCTTTATGCCGACGTCCTC
TTTGTCGCGGGCGCACTCGTCCAAGCCTTCTGCTCGACCGTGCCGCTCATGGTCGCCGGTCGGTGCATCGTTGGC
GCTGGCGTCGGCGCCGCGAGCTTCGTCGTGCCGCTGTATATTGCTGAAGTGGCGCCAGCTTCGCATCGCGGCAAG
CTGGTGACGACCAATGTTCTGTTCATTACCCTGGGCCAGATGGTAGCCTATATCGTCGGCTGGCTTCTTTCGACC
TATACGGCCAAGGAGACGGGCTGGCGTTGGATGGTAGGACTCGGCGCCATGCCCGCCGCTCTACAAGGGGCCATT
ATCGTCCTGATGCCCGAGACGCCCCGCTGGCTGGTCAAGGTCGGCCGCTTGGCGGAGGCCAGACTCGTCATGCGG
CGAGTCGAGCCGGGATCGACGCGAGACGCCGACGCCGTGGTGGCTGAGATGGAAGCGGAGGTGCGCGAGGAACGC
GAGTCGAGGCGGAAGCGAGGGCACGGCGCTTGGGGTCTTGCGTGGCGGGAGCTTCTAGGCGAGGCAAGGAACCGC
AGGGCGCTGGCGCTGGCCTGCCTGCTACAAGGCCTTCAGCAGCTGTGCGGGTTTAACTCGCTCATGTACTACTCG
GCCACCATCTTTGCGCTTGTGGGCTTCGTGAGCCCGACGCTGACGGCGCTGACGGTGGCAGTGACCAATTTTGTC
CTGACGCTGGCGGCGCTGGGCCTGATTGACCGGGTGGGCAGGCGGCGCATACTGCTCTGGTCGATGCCGGGCATG
GTGCTGGGGCTCGTGGCCGCCGCCGCCGGCTTCTCCATACTGCCACTGGACGCCACGGCAGTGGGCGAGGCCGAC
GACGGAGGCCCGGCGCGGCTGATACTGGCCAGCATCATGGTCTACGTGGCGGCCTACGCGCTAGGACTGGGCAAC
GTGCCGTGGATGCAGAGCGAGCTGTTCCCATTGACGGTGCGGTCGGTAGGCAGCGGCGTGGCGACGGCAACCAAC
TGGACGGCCAACTTGATCGTCGGATTGACTTTTCTGCCCATGATGGAGGCACTCAGTCCGGCGTGGACGATGGCA
ACTTACGCGGCCGTGTGCTGCGTCGGCTACGTGCTGGTGTGGCGCATCTATCCTGAGACGGCTGGGCTGAGTCTG
GAGGAGGCGACGAGCCTGTTGGAGCACGGATGGGGCGTTGGCAGG
Transcript >Ophio5|1608
ATGCGCCCCTGCAATCCACACCCGGCCCAATTCACTCATGGCAGGAGGCCTCATCCGGCACTCCCAACCCAAGCC
ATCATGGACAGCCCCCGAGCGCCGTTGATGGCTGACCACGACGGTCTGGCCGATGAAGTCGAGCCGACCGCCTTC
CACAGCGAGGCCGCCCCGCGCGGGCCGGTAAAGCCGGTCGAGACGGGTCCTGGCATCTTCGTCCAGGCGCTGACC
TTGGCGGCGGGCATCAGCGGCCTCCTTTTTGGATACGACACGGGCGTCATATCGGCGACTCTCGTTTCAATAGGA
ACTTCGCTCTCGAACCGACCACTGACGTCCATGGACAAGTCCATGATTACGTCGTCCGTGGCGCTCTTTGCCCTC
ATCACGTCTTCCTTGTCCTCGATTCTCGCTGATAAGTTCGGTCGTAAACGCGTCATTCTTTATGCCGACGTCCTC
TTTGTCGCGGGCGCACTCGTCCAAGCCTTCTGCTCGACCGTGCCGCTCATGGTCGCCGGTCGGTGCATCGTTGGC
GCTGGCGTCGGCGCCGCGAGCTTCGTCGTGCCGCTGTATATTGCTGAAGTGGCGCCAGCTTCGCATCGCGGCAAG
CTGGTGACGACCAATGTTCTGTTCATTACCCTGGGCCAGATGGTAGCCTATATCGTCGGCTGGCTTCTTTCGACC
TATACGGCCAAGGAGACGGGCTGGCGTTGGATGGTAGGACTCGGCGCCATGCCCGCCGCTCTACAAGGGGCCATT
ATCGTCCTGATGCCCGAGACGCCCCGCTGGCTGGTCAAGGTCGGCCGCTTGGCGGAGGCCAGACTCGTCATGCGG
CGAGTCGAGCCGGGATCGACGCGAGACGCCGACGCCGTGGTGGCTGAGATGGAAGCGGAGGTGCGCGAGGAACGC
GAGTCGAGGCGGAAGCGAGGGCACGGCGCTTGGGGTCTTGCGTGGCGGGAGCTTCTAGGCGAGGCAAGGAACCGC
AGGGCGCTGGCGCTGGCCTGCCTGCTACAAGGCCTTCAGCAGCTGTGCGGGTTTAACTCGCTCATGTACTACTCG
GCCACCATCTTTGCGCTTGTGGGCTTCGTGAGCCCGACGCTGACGGCGCTGACGGTGGCAGTGACCAATTTTGTC
CTGACGCTGGCGGCGCTGGGCCTGATTGACCGGGTGGGCAGGCGGCGCATACTGCTCTGGTCGATGCCGGGCATG
GTGCTGGGGCTCGTGGCCGCCGCCGCCGGCTTCTCCATACTGCCACTGGACGCCACGGCAGTGGGCGAGGCCGAC
GACGGAGGCCCGGCGCGGCTGATACTGGCCAGCATCATGGTCTACGTGGCGGCCTACGCGCTAGGACTGGGCAAC
GTGCCGTGGATGCAGAGCGAGCTGTTCCCATTGACGGTGCGGTCGGTAGGCAGCGGCGTGGCGACGGCAACCAAC
TGGACGGCCAACTTGATCGTCGGATTGACTTTTCTGCCCATGATGGAGGCACTCAGTCCGGCGTGGACGATGGCA
ACTTACGCGGCCGTGTGCTGCGTCGGCTACGTGCTGGTGTGGCGCATCTATCCTGAGACGGCTGGGCTGAGTCTG
GAGGAGGCGACGAGCCTGTTGGAGCACGGATGGGGCGTTGGCAGGTGA
Gene >Ophio5|1608
ATGGTGCGTGCAAAAAACGGATTCTTGCAAGATAATCGCACACCTGCCGCGACCTCACTCGTGATTGTCATCGGC
CTTGCGACCAACAGCGCCCCTGCAATCCGTCGTCTAATCCGGCGTCTCGCATGTCTCCCACAGCAGACACCCGGC
CGTACGTGCCCTGGACTGGCTAGAGCTGGCATGTCACTGAACGCCTGCAGCAATTCACTCATGGCAGGAGGCCTC
ATCCGGCACTCCCAACCCAAGCCATCATGGACAGCCCCCGAGCGCCGTTGATGGCTGACCACGACGGTCTGGCCG
ATGAAGTCGAGCCGACCGCCTTCCACAGCGAGGCCGCCCCGCGCGGGCCGGTAAAGCCGGTCGAGACGGGTCCTG
GCATCTTCGTCCAGGCGCTGACCTTGGCGGCGGGCATCAGCGGCCTCCTTTTTGGATGCAAGTAGCGAGTCTCGC
CCCAGGGCTTCACAGGCTGATGGCGACCCGTCGCCCGCAGACGACACGGGCGTCATATCGGCGACTCTCGTTTCA
ATAGGAACTTCGCTCTCGAACCGACCACTGACGTCCATGGACAAGTCCATGATTACGTCGTCCGTGGCGCTCTTT
GCCCTCATCACGTCTTCCTTGTCCTCGATTCTCGCTGATAAGTTCGGTCGTAAACGCGTCATTCTTTATGCCGAC
GTCCTCTTTGTCGCGGGCGCACTCGTCCAAGCCTTCTGCTCGACCGTGCCGCTCATGGTCGCCGGTCGGTGCATC
GTTGGCGCTGGCGTCGGCGCCGCGAGCTTCGTCGTGCCGCTGTATATTGCTGAAGTGGCGCCAGCTTCGCATCGC
GGCAAGCTGGTGACGACCAATGTTCTGTTCATTACCCTGGGCCAGATGGTAGCCTATATCGTCGGCTGGCTTCTT
TCGACCTATACGGCCAAGGAGACGGGCTGGCGTTGGATGGTAGGACTCGGCGCCATGCCCGCCGCTCTACAAGGG
GCCATTATCGTCCTGATGCCCGAGACGCCCCGCTGGCTGGTCAAGGTCGGCCGCTTGGCGGAGGCCAGACTCGTC
ATGCGGCGAGTCGAGCCGGGATCGACGCGAGACGCCGACGCCGTGGTGGCTGAGATGGAAGCGGAGGTGCGCGAG
GAACGCGAGTCGAGGCGGAAGCGAGGGCACGGCGCTTGGGGTCTTGCGTGGCGGGAGCTTCTAGGCGAGGCAAGG
AACCGCAGGGCGCTGGCGCTGGCCTGCCTGCTACAAGGCCTTCAGCAGCTGTGCGGGTTTGTACGTGTTCCACCC
TTTCTTGTGTGTCGGCGTCCACTGACGGCGGTTCGCGCAGAACTCGCTCATGTACTACTCGGCCACCATCTTTGC
GCTTGTGGGCTTCGTGAGCCCGACGCTGACGGCGCTGACGGTGGCAGTGACCAATTTTGTCCTGACGCTGGCGGC
GCTGGGCCTGATTGACCGGGTGGGCAGGCGGCGCATACTGCTCTGGTCGATGCCGGGCATGGTGCTGGGGCTCGT
GGCCGCCGCCGCCGGCTTCTCCATACTGCCACTGGACGCCACGGCAGTGGGCGAGGCCGACGACGGAGGCCCGGC
GCGGCTGATACTGGCCAGCATCATGGTCTACGTGGCGGCCTACGCGCTAGGACTGGGCAACGTGCCGTGGATGCA
GAGCGAGCTGTTCCCATTGACGGTGCGGTCGGTAGGCAGCGGCGTGGCGACGGCAACCAACTGGACGGCCAACTT
GATCGTCGGATTGACTTTTCTGCCCATGATGGAGGCACTCAGTCCGGCGTGGACGATGGCAACTTACGCGGCCGT
GTGCTGCGTCGGCTACGTGCTGGTGTGGCGCATCTATCCTGAGACGGCTGGGCTGAGTCTGGAGGAGGCGACGAG
CCTGTTGGAGCACGGATGGGGCGTTGGCAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail