Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1607
Gene name
Locationscaffold_159:5290..12098
Strand-
Gene length (bp)6808
Transcript length (bp)5670
Coding sequence length (bp)5667
Protein length (aa) 1889

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.0E-40 150 535
PF00168 C2 C2 domain 4.8E-15 1172 1272
PF00168 C2 C2 domain 3.5E-08 1358 1488

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USG8|MU190_SCHPO Meiotically up-regulated gene 190 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug190 PE=1 SV=1 700 1889 0.0E+00
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 128 580 7.0E-143
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 119 582 8.0E-143
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 119 582 3.0E-139
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 113 580 6.0E-132
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USG8|MU190_SCHPO Meiotically up-regulated gene 190 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug190 PE=1 SV=1 700 1889 0.0E+00
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 128 580 7.0E-143
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 119 582 8.0E-143
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 119 582 3.0E-139
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 113 580 6.0E-132
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 108 580 3.0E-127
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 106 582 9.0E-124
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 119 581 2.0E-96
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 119 582 2.0E-94
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 63 580 4.0E-88
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 119 582 1.0E-80
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 61 578 2.0E-76
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 114 581 1.0E-75
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 61 578 6.0E-75
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 129 582 6.0E-75
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 130 584 4.0E-72
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 130 584 6.0E-72
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 122 582 3.0E-71
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 119 581 2.0E-70
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 128 582 3.0E-66
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 122 582 6.0E-66
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 116 582 2.0E-65
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 122 582 1.0E-60
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 122 582 2.0E-60
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 119 579 4.0E-58
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 130 581 2.0E-54
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 129 579 3.0E-40
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 128 595 8.0E-39
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 129 582 7.0E-34
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 65 357 4.0E-23
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 435 584 2.0E-19
sp|Q9UT00|YKH3_SCHPO Uncharacterized protein PYUK71.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPYUK71.03c PE=1 SV=1 929 1549 2.0E-18
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 141 430 7.0E-18
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 140 429 2.0E-15
sp|Q12466|TCB1_YEAST Tricalbin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB1 PE=1 SV=1 929 1510 3.0E-15
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 133 323 1.0E-13
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 140 428 7.0E-12
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 142 323 9.0E-12
sp|P48231|TCB2_YEAST Tricalbin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB2 PE=1 SV=1 908 1517 3.0E-11
sp|Q1RI77|BCRH_RICBR Uncharacterized transporter RBE_0856 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0856 PE=3 SV=1 144 309 5.0E-11
sp|Q4UMJ9|BCRH_RICFE Uncharacterized transporter RF_0358 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0358 PE=3 SV=1 144 431 7.0E-11
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 159 578 1.0E-10
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 145 577 2.0E-10
sp|O14065|YC31_SCHPO Uncharacterized protein C962.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC962.01 PE=2 SV=3 929 1250 7.0E-10
sp|Q68WD6|BCRH_RICTY Uncharacterized transporter RT0591 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0591 PE=3 SV=1 149 323 1.0E-09
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 137 474 2.0E-09
sp|Q9ZCV6|BCRH_RICPR Uncharacterized transporter RP603 OS=Rickettsia prowazekii (strain Madrid E) GN=RP603 PE=3 SV=1 144 323 2.0E-09
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 169 477 3.0E-09
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 128 324 1.0E-08
sp|Q9BSJ8|ESYT1_HUMAN Extended synaptotagmin-1 OS=Homo sapiens GN=ESYT1 PE=1 SV=1 878 1232 2.0E-08
sp|Q9SKR2|SYT1_ARATH Synaptotagmin-1 OS=Arabidopsis thaliana GN=SYT1 PE=1 SV=2 1065 1277 3.0E-08
sp|Q8L706|SYT5_ARATH Synaptotagmin-5 OS=Arabidopsis thaliana GN=SYT5 PE=2 SV=1 1059 1489 8.0E-08
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 142 581 8.0E-08
sp|Q5RAG2|ESYT1_PONAB Extended synaptotagmin-1 OS=Pongo abelii GN=ESYT1 PE=2 SV=2 878 1232 2.0E-07
sp|Q03640|TCB3_YEAST Tricalbin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB3 PE=1 SV=1 929 1298 3.0E-07
sp|Q5DTI8|ESYT3_MOUSE Extended synaptotagmin-3 OS=Mus musculus GN=Esyt3 PE=2 SV=2 1076 1272 4.0E-07
sp|Q7XA06|SYT3_ARATH Synaptotagmin-3 OS=Arabidopsis thaliana GN=SYT3 PE=2 SV=1 1069 1275 4.0E-07
sp|Q9Z1X1|ESYT1_RAT Extended synaptotagmin-1 OS=Rattus norvegicus GN=Esyt1 PE=1 SV=1 878 1232 4.0E-07
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 438 578 5.0E-07
sp|B4EYY4|MDTG_PROMH Multidrug resistance protein MdtG OS=Proteus mirabilis (strain HI4320) GN=mdtG PE=3 SV=1 193 440 5.0E-07
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 143 315 7.0E-07
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 143 315 7.0E-07
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 158 569 1.0E-06
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 138 323 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 154 176 22
2 181 203 22
3 210 229 19
4 235 257 22
5 269 291 22
6 301 320 19
7 376 398 22
8 413 432 19
9 453 475 22
10 480 502 22
11 515 537 22
12 547 569 22
13 862 879 17
14 883 900 17
15 1055 1077 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1607
MRMDVASQEVADAEADAIAPEQYQQRNSDEIERIVSVSTATTASSMGPSTTHGMRHRMSYVSTHRDLERHYTELS
RIETQRTQHIGTVGSAGGSVRENRKPLPSFGAGKPFPPPLPARDEYVVEFDGPDDPLNAQNWPTHTKIIMAAMMS
FTTFVSSFTSSIYSPAIATISQYFHVDSEVALLGTTLYVLGFAFGPSLWAPLSELRGRRLPINLSMFGFSVFCIG
AATAKDIQTLLICRFFSGFFGSCSLAVVAAIFSDMFNNVTRGIAITFFTMTVFTGPLLAPFIGGFIVESYLGWRW
TLYLPTILGFAAFFLDFFFLKESYAPVILVEKAGELRRRTRNWGIHAKQEEIEIDFAELVNKNFARPMRMLFTEP
ILFFLTLYMSFMYGLLYLFLTAYNLVFVGIHHFSLGDAGLTFFGMVIGVFIAGIVVLAQQPWYKRKLASNNGVPV
PEWRLPSVMAGGVCFVIGIFWFGWTGYKADIPWIAPAASGIFTGFGLMSIFLQAINYIVDAYLMFAASALAGNTF
MRSLAGATFPLFARQMFVGMGIQWASTLLGCLALLMCPIPFVFYKYGRKLREKSKFAPTPPRPAPSHSSEEVGNG
ETVTEKKKRDHSTASRDTAVLSTDSASAAALGSVRSRDSDNPAAADPGTNTYIDTRIPPLSKPQLKHSWALYEYE
KPVLYFCHDARQGCRMDVEEHVAPSGQHYSGRNRIPNIKQFAEQLDLEKRNRDAVIDAELHKNSEGREHQTAQKS
RRDNTRTVRDPVTGKDVGIRDADADYKAAVDDPQLSVPNENLGRPTTVRVSSQQSGEEYRRNQDITAPPAPVQEG
ATSDVPISSEKTSILFYKTPSVSYEPMFAALERKATVLCFGIFIAIIFMGKMFGGRLLGLVPLAGCVASGVFLWA
KDIVRQGRDMEWSSEQQRGETATANLIPESVEWMNTAIGIVWGLINPEMFASVADTLEDVMVASVPGVIENVRVA
DISQGSNPLRILSIRALPDSHVKDIKQEIHRDNEKTMDPNELAAVEQAGSFYNMEVSVAYHAKPSGEDITSKAKN
MGMQLVFYLGVKGLFGVPLPVWVELVGLVATARVRLQLTPDPPFLKTLSVTLMGVPKVQAGCTPMIEKGVNVLNL
PLISNFVNWAIRTAASMYVAPKSLTLDMSKMLAGDDIKKETQALGVVFIRIHKATGLSKQDHSGSRGGGSDPYIT
VSWSKFSKPQFCTRVIQDDLNPVFEETCGLLVTSDLIKADEKLSMELWDSDRSSADDVVGKVELSIQKLIQHPGK
MFPQVSHLCGVKADSSMPGQLHWEVGFFGKTQFRKALRTDGRDATLPKALADKPELQDQRGSIDSKEEDAVVHTP
PDPLWPSGILSIVVHQIVGLELANIKGSDGKRKGKEYEPARPEAGEVKEEQGQKLPSSYCTVLLNDSLVYKTRIK
AVSSQPIFNAGTEKFVRDWRSCIATIAVRDSRNRQHDPIIGVVPLQLSDVLRTSSQVTRWYPLDGGIGFGRIRIS
ILFRSVELRLPPPQLGWDIGTFEFTSDSITTTGYAPSQSVKLKLRTGGSSATVKKSFSIREETGMRIDISGGEDG
KGMRLPVRHRYRCPIFLEFYSTSSRKPDAYAALWLLELSDGEDEDFDVPIFTCSNGLRLSQNYITQENYQEIPDL
EIEEVGRARFRGRFSPGTDSDHMKFVCDNDSRETIETWEACYAEGVRKQEVKAEVPPLVMELHDQSLTHGRDVLA
QANEDDKQRWLAKDGTDWSGAFGKDPRDLMASKSDGGQGQDGAGEDYDDSSSSDSDPDLGIEEHPDASGDKADQG
RPSTDSKNESSSSSSSSSSPGGGSSKNPYTMYKNYTARNRDLHRKHRGLMQWRPIRNAQFAKDEAKFALRKVKNL
GGLGGRQPDVETEV
Coding >Ophio5|1607
ATGCGCATGGACGTTGCGAGCCAAGAGGTGGCCGATGCCGAGGCCGACGCCATCGCTCCCGAGCAGTATCAACAG
CGCAATAGCGATGAGATTGAGCGTATCGTGTCCGTCTCGACGGCCACGACAGCGTCTTCGATGGGTCCCAGCACT
ACGCACGGCATGCGCCACCGAATGAGCTACGTCTCGACACATCGCGACCTCGAGCGTCACTACACCGAGCTGAGC
CGCATCGAGACGCAACGGACTCAGCACATTGGTACGGTGGGAAGCGCCGGCGGCAGTGTCCGGGAAAATCGCAAG
CCTCTTCCGTCTTTCGGCGCCGGCAAGCCTTTTCCTCCGCCGCTGCCGGCCCGTGACGAGTATGTGGTCGAATTT
GACGGCCCCGACGACCCTCTCAACGCCCAGAACTGGCCGACGCACACCAAGATCATCATGGCCGCTATGATGTCG
TTTACAACCTTTGTCTCGTCCTTTACCTCGTCCATCTACTCACCCGCCATTGCCACCATCTCCCAATACTTCCAC
GTTGACAGCGAGGTCGCCCTGCTCGGCACGACGCTCTACGTCCTGGGCTTCGCCTTCGGCCCCTCGCTGTGGGCT
CCCCTCTCGGAACTGCGTGGCCGCCGACTGCCCATTAACCTCTCCATGTTTGGCTTCTCCGTCTTCTGCATTGGC
GCAGCCACGGCCAAGGATATTCAGACACTCCTCATCTGTCGCTTCTTTAGCGGCTTCTTCGGCTCCTGCTCGCTC
GCCGTCGTCGCCGCCATCTTCTCCGACATGTTCAACAACGTGACGCGCGGCATCGCCATCACCTTCTTCACCATG
ACCGTCTTCACGGGGCCGCTCCTCGCCCCCTTCATCGGCGGCTTCATCGTCGAGTCGTACCTCGGCTGGCGATGG
ACCTTGTATCTGCCCACTATCTTGGGCTTCGCCGCCTTTTTCCTCGACTTCTTCTTTCTCAAGGAGTCGTATGCG
CCCGTCATCCTCGTCGAAAAGGCGGGCGAATTGCGGCGCCGCACTCGCAACTGGGGCATCCACGCCAAGCAGGAA
GAAATCGAAATCGACTTCGCCGAGCTCGTCAACAAGAACTTTGCCCGGCCCATGCGTATGCTCTTTACCGAGCCC
ATCCTCTTCTTCCTCACCCTTTACATGAGCTTCATGTACGGCCTACTCTATCTCTTCCTCACCGCCTACAACCTA
GTCTTTGTCGGAATCCACCACTTCAGCCTAGGCGACGCCGGCCTGACGTTTTTCGGCATGGTCATCGGCGTCTTC
ATTGCCGGCATCGTCGTCCTCGCCCAGCAGCCGTGGTACAAGCGCAAGCTGGCCAGCAACAACGGCGTTCCGGTG
CCTGAATGGCGGCTGCCCAGCGTCATGGCCGGCGGCGTCTGTTTCGTCATTGGCATCTTTTGGTTCGGATGGACT
GGATACAAAGCTGACATTCCCTGGATCGCGCCCGCGGCCAGCGGCATCTTCACCGGCTTCGGACTCATGTCCATC
TTTCTGCAGGCCATCAACTACATCGTCGACGCCTACCTCATGTTTGCCGCTTCGGCCCTCGCTGGCAACACCTTT
ATGCGATCTCTCGCAGGCGCCACCTTTCCGCTCTTTGCGAGGCAGATGTTCGTGGGCATGGGAATTCAGTGGGCG
TCGACGCTTCTGGGCTGCTTGGCCCTGCTGATGTGTCCGATCCCGTTCGTCTTCTACAAGTACGGCCGCAAGCTC
CGGGAGAAGAGCAAGTTCGCCCCGACGCCGCCCAGACCGGCGCCCTCACACTCGTCCGAAGAGGTCGGCAACGGC
GAGACGGTGACGGAGAAGAAGAAGCGAGATCACTCTACGGCCAGTCGCGACACGGCGGTGCTGAGTACGGACTCG
GCGTCGGCGGCGGCGCTGGGGAGCGTGCGGTCAAGGGACAGCGACAACCCTGCAGCTGCCGATCCCGGGACAAAT
ACATACATAGACACACGCATCCCGCCTTTGTCCAAGCCTCAATTGAAACACTCGTGGGCTCTCTACGAGTACGAG
AAGCCGGTCCTCTACTTCTGTCACGACGCACGACAAGGCTGCCGGATGGACGTTGAAGAGCATGTGGCGCCCTCG
GGCCAGCACTACAGCGGACGCAACCGCATCCCCAACATCAAGCAGTTCGCCGAGCAGCTCGACCTGGAGAAGCGA
AATCGCGATGCCGTGATCGACGCCGAGCTTCACAAGAATAGCGAGGGGCGGGAGCATCAGACGGCACAAAAGAGC
AGGCGTGACAACACACGCACCGTTCGCGATCCAGTAACTGGTAAGGATGTCGGCATCCGCGACGCCGATGCCGAC
TACAAGGCGGCCGTCGACGACCCTCAACTGTCCGTCCCCAACGAAAACCTCGGCAGGCCTACCACGGTGAGAGTG
TCGTCGCAACAGTCCGGCGAGGAGTACCGCCGCAACCAGGACATCACGGCACCCCCCGCCCCGGTTCAGGAAGGG
GCCACATCGGACGTACCCATCAGCAGCGAGAAGACGTCGATTCTGTTTTACAAGACGCCGTCGGTCAGCTACGAG
CCCATGTTTGCCGCCCTCGAGCGCAAGGCCACTGTCTTATGCTTTGGTATTTTCATTGCCATCATCTTCATGGGC
AAAATGTTTGGCGGCAGGCTCCTCGGCCTCGTCCCCCTGGCTGGCTGCGTCGCCTCGGGCGTCTTCCTCTGGGCC
AAGGATATCGTCCGTCAGGGCAGGGATATGGAGTGGTCGAGCGAGCAGCAGCGCGGTGAGACTGCTACCGCCAAC
TTGATTCCCGAGTCTGTGGAGTGGATGAACACGGCCATTGGCATTGTCTGGGGCCTCATCAATCCCGAAATGTTT
GCCTCTGTCGCCGATACCCTGGAGGACGTCATGGTTGCGTCGGTGCCGGGCGTCATTGAAAACGTCCGCGTCGCC
GACATATCCCAGGGCAGCAACCCTCTTCGAATCCTTAGCATAAGAGCTTTGCCAGACTCTCACGTCAAAGACATT
AAGCAGGAGATACATCGAGACAACGAAAAGACCATGGATCCCAACGAACTGGCAGCCGTCGAGCAGGCCGGCTCC
TTTTACAACATGGAGGTTTCCGTCGCCTACCACGCCAAGCCATCGGGTGAAGACATCACGTCCAAGGCTAAGAAC
ATGGGCATGCAGCTCGTCTTCTATCTCGGTGTCAAGGGCCTCTTCGGCGTTCCGCTGCCCGTCTGGGTCGAGCTG
GTTGGGCTCGTGGCGACAGCTCGTGTGCGGCTGCAATTGACGCCCGATCCGCCGTTCCTCAAGACGCTCAGCGTC
ACGCTCATGGGCGTCCCCAAGGTACAAGCCGGGTGCACGCCCATGATCGAAAAGGGCGTCAACGTCCTGAACCTG
CCGCTCATCTCCAACTTTGTCAACTGGGCCATACGCACGGCCGCGTCAATGTACGTGGCGCCGAAGAGCTTGACG
TTGGATATGAGCAAGATGCTTGCGGGGGACGACATCAAGAAGGAGACGCAGGCCCTGGGTGTCGTATTCATTCGC
ATCCACAAGGCAACTGGCCTCAGCAAGCAGGATCACTCGGGCAGCCGCGGCGGCGGCTCGGATCCGTACATCACC
GTCAGCTGGAGCAAGTTCTCCAAGCCACAGTTCTGCACGCGCGTCATCCAGGATGACCTGAACCCAGTCTTTGAA
GAGACTTGCGGCCTCTTGGTCACGAGCGACCTGATCAAGGCCGACGAGAAGCTCTCGATGGAGCTCTGGGACAGC
GATCGCTCTTCGGCAGATGACGTCGTGGGCAAGGTCGAACTCAGCATCCAGAAGCTCATTCAGCACCCAGGCAAG
ATGTTCCCCCAGGTGTCCCATCTCTGCGGCGTCAAGGCCGACAGCAGCATGCCTGGTCAGCTCCACTGGGAGGTA
GGCTTTTTCGGCAAGACGCAGTTCCGTAAAGCCCTGCGAACCGATGGCCGCGACGCCACCCTCCCCAAAGCGTTG
GCCGATAAGCCTGAGCTCCAGGACCAGAGAGGCAGCATCGACTCCAAGGAGGAGGATGCCGTGGTCCACACGCCG
CCCGACCCTCTCTGGCCATCGGGCATCCTCAGCATCGTCGTCCATCAGATCGTGGGCCTGGAGCTTGCCAATATC
AAGGGCTCCGACGGGAAGCGCAAGGGCAAGGAGTACGAGCCGGCGCGGCCCGAGGCAGGCGAGGTCAAGGAGGAG
CAGGGCCAGAAGCTTCCGAGTTCCTACTGCACCGTCTTGCTTAACGATAGTTTGGTGTACAAGACGCGCATCAAG
GCCGTGTCGTCACAGCCCATCTTTAACGCCGGGACCGAGAAGTTTGTCCGCGACTGGAGGTCCTGCATCGCTACC
ATAGCCGTCCGCGACTCGCGGAACAGGCAGCACGACCCTATCATCGGGGTGGTGCCTCTGCAGCTGTCGGACGTG
CTGCGGACGAGCAGCCAGGTGACTCGATGGTATCCTCTCGATGGCGGCATCGGGTTCGGCCGCATCCGCATCTCT
ATCCTCTTCCGTTCGGTTGAGCTCCGTCTGCCCCCGCCGCAGCTCGGCTGGGACATTGGCACGTTTGAGTTCACG
TCGGACAGCATCACCACGACGGGTTACGCACCGTCTCAGAGCGTCAAGCTGAAACTGCGCACGGGCGGATCGTCT
GCCACGGTCAAGAAGAGCTTTTCCATCAGGGAGGAGACCGGGATGCGGATAGACATCAGCGGCGGGGAAGACGGA
AAGGGAATGCGACTCCCCGTCCGTCACCGGTATCGATGCCCCATCTTCCTCGAGTTTTACTCGACAAGCAGTCGC
AAGCCCGATGCCTACGCTGCTCTTTGGCTGCTAGAGCTCAGCGACGGGGAAGATGAGGATTTTGACGTTCCCATC
TTTACGTGTAGCAACGGCCTGCGCCTCTCGCAAAACTACATCACCCAAGAAAACTACCAGGAAATTCCCGACCTC
GAGATTGAAGAGGTTGGCCGCGCACGGTTCCGGGGTCGCTTCTCCCCGGGCACCGACTCGGACCACATGAAGTTT
GTGTGCGACAACGACTCCCGCGAGACGATTGAGACGTGGGAGGCCTGCTATGCCGAGGGCGTGCGGAAGCAGGAG
GTGAAGGCCGAGGTGCCTCCGCTGGTGATGGAGTTGCACGACCAGTCCTTGACGCATGGCCGAGACGTGCTCGCC
CAGGCCAACGAAGACGACAAGCAGCGGTGGCTGGCCAAGGACGGCACGGACTGGAGCGGTGCCTTTGGCAAGGAC
CCCAGGGATCTGATGGCGAGCAAGTCGGACGGGGGCCAAGGTCAGGACGGTGCTGGGGAGGATTACGACGACAGC
AGTTCCAGCGATAGCGACCCCGATCTCGGCATCGAGGAGCACCCGGACGCTTCGGGTGACAAGGCCGACCAAGGC
AGGCCGTCGACGGACTCCAAGAATGAGTCGTCGTCGTCGTCTTCGTCGTCGTCTTCGCCCGGCGGCGGAAGCAGC
AAGAACCCGTACACCATGTACAAGAACTACACGGCGCGCAACCGCGACTTGCACCGGAAGCACCGCGGGTTGATG
CAGTGGCGACCGATCCGCAACGCGCAATTCGCCAAGGACGAGGCCAAGTTTGCGCTGCGTAAGGTGAAGAATCTG
GGGGGTTTGGGAGGACGACAGCCGGATGTGGAGACTGAGGTT
Transcript >Ophio5|1607
ATGCGCATGGACGTTGCGAGCCAAGAGGTGGCCGATGCCGAGGCCGACGCCATCGCTCCCGAGCAGTATCAACAG
CGCAATAGCGATGAGATTGAGCGTATCGTGTCCGTCTCGACGGCCACGACAGCGTCTTCGATGGGTCCCAGCACT
ACGCACGGCATGCGCCACCGAATGAGCTACGTCTCGACACATCGCGACCTCGAGCGTCACTACACCGAGCTGAGC
CGCATCGAGACGCAACGGACTCAGCACATTGGTACGGTGGGAAGCGCCGGCGGCAGTGTCCGGGAAAATCGCAAG
CCTCTTCCGTCTTTCGGCGCCGGCAAGCCTTTTCCTCCGCCGCTGCCGGCCCGTGACGAGTATGTGGTCGAATTT
GACGGCCCCGACGACCCTCTCAACGCCCAGAACTGGCCGACGCACACCAAGATCATCATGGCCGCTATGATGTCG
TTTACAACCTTTGTCTCGTCCTTTACCTCGTCCATCTACTCACCCGCCATTGCCACCATCTCCCAATACTTCCAC
GTTGACAGCGAGGTCGCCCTGCTCGGCACGACGCTCTACGTCCTGGGCTTCGCCTTCGGCCCCTCGCTGTGGGCT
CCCCTCTCGGAACTGCGTGGCCGCCGACTGCCCATTAACCTCTCCATGTTTGGCTTCTCCGTCTTCTGCATTGGC
GCAGCCACGGCCAAGGATATTCAGACACTCCTCATCTGTCGCTTCTTTAGCGGCTTCTTCGGCTCCTGCTCGCTC
GCCGTCGTCGCCGCCATCTTCTCCGACATGTTCAACAACGTGACGCGCGGCATCGCCATCACCTTCTTCACCATG
ACCGTCTTCACGGGGCCGCTCCTCGCCCCCTTCATCGGCGGCTTCATCGTCGAGTCGTACCTCGGCTGGCGATGG
ACCTTGTATCTGCCCACTATCTTGGGCTTCGCCGCCTTTTTCCTCGACTTCTTCTTTCTCAAGGAGTCGTATGCG
CCCGTCATCCTCGTCGAAAAGGCGGGCGAATTGCGGCGCCGCACTCGCAACTGGGGCATCCACGCCAAGCAGGAA
GAAATCGAAATCGACTTCGCCGAGCTCGTCAACAAGAACTTTGCCCGGCCCATGCGTATGCTCTTTACCGAGCCC
ATCCTCTTCTTCCTCACCCTTTACATGAGCTTCATGTACGGCCTACTCTATCTCTTCCTCACCGCCTACAACCTA
GTCTTTGTCGGAATCCACCACTTCAGCCTAGGCGACGCCGGCCTGACGTTTTTCGGCATGGTCATCGGCGTCTTC
ATTGCCGGCATCGTCGTCCTCGCCCAGCAGCCGTGGTACAAGCGCAAGCTGGCCAGCAACAACGGCGTTCCGGTG
CCTGAATGGCGGCTGCCCAGCGTCATGGCCGGCGGCGTCTGTTTCGTCATTGGCATCTTTTGGTTCGGATGGACT
GGATACAAAGCTGACATTCCCTGGATCGCGCCCGCGGCCAGCGGCATCTTCACCGGCTTCGGACTCATGTCCATC
TTTCTGCAGGCCATCAACTACATCGTCGACGCCTACCTCATGTTTGCCGCTTCGGCCCTCGCTGGCAACACCTTT
ATGCGATCTCTCGCAGGCGCCACCTTTCCGCTCTTTGCGAGGCAGATGTTCGTGGGCATGGGAATTCAGTGGGCG
TCGACGCTTCTGGGCTGCTTGGCCCTGCTGATGTGTCCGATCCCGTTCGTCTTCTACAAGTACGGCCGCAAGCTC
CGGGAGAAGAGCAAGTTCGCCCCGACGCCGCCCAGACCGGCGCCCTCACACTCGTCCGAAGAGGTCGGCAACGGC
GAGACGGTGACGGAGAAGAAGAAGCGAGATCACTCTACGGCCAGTCGCGACACGGCGGTGCTGAGTACGGACTCG
GCGTCGGCGGCGGCGCTGGGGAGCGTGCGGTCAAGGGACAGCGACAACCCTGCAGCTGCCGATCCCGGGACAAAT
ACATACATAGACACACGCATCCCGCCTTTGTCCAAGCCTCAATTGAAACACTCGTGGGCTCTCTACGAGTACGAG
AAGCCGGTCCTCTACTTCTGTCACGACGCACGACAAGGCTGCCGGATGGACGTTGAAGAGCATGTGGCGCCCTCG
GGCCAGCACTACAGCGGACGCAACCGCATCCCCAACATCAAGCAGTTCGCCGAGCAGCTCGACCTGGAGAAGCGA
AATCGCGATGCCGTGATCGACGCCGAGCTTCACAAGAATAGCGAGGGGCGGGAGCATCAGACGGCACAAAAGAGC
AGGCGTGACAACACACGCACCGTTCGCGATCCAGTAACTGGTAAGGATGTCGGCATCCGCGACGCCGATGCCGAC
TACAAGGCGGCCGTCGACGACCCTCAACTGTCCGTCCCCAACGAAAACCTCGGCAGGCCTACCACGGTGAGAGTG
TCGTCGCAACAGTCCGGCGAGGAGTACCGCCGCAACCAGGACATCACGGCACCCCCCGCCCCGGTTCAGGAAGGG
GCCACATCGGACGTACCCATCAGCAGCGAGAAGACGTCGATTCTGTTTTACAAGACGCCGTCGGTCAGCTACGAG
CCCATGTTTGCCGCCCTCGAGCGCAAGGCCACTGTCTTATGCTTTGGTATTTTCATTGCCATCATCTTCATGGGC
AAAATGTTTGGCGGCAGGCTCCTCGGCCTCGTCCCCCTGGCTGGCTGCGTCGCCTCGGGCGTCTTCCTCTGGGCC
AAGGATATCGTCCGTCAGGGCAGGGATATGGAGTGGTCGAGCGAGCAGCAGCGCGGTGAGACTGCTACCGCCAAC
TTGATTCCCGAGTCTGTGGAGTGGATGAACACGGCCATTGGCATTGTCTGGGGCCTCATCAATCCCGAAATGTTT
GCCTCTGTCGCCGATACCCTGGAGGACGTCATGGTTGCGTCGGTGCCGGGCGTCATTGAAAACGTCCGCGTCGCC
GACATATCCCAGGGCAGCAACCCTCTTCGAATCCTTAGCATAAGAGCTTTGCCAGACTCTCACGTCAAAGACATT
AAGCAGGAGATACATCGAGACAACGAAAAGACCATGGATCCCAACGAACTGGCAGCCGTCGAGCAGGCCGGCTCC
TTTTACAACATGGAGGTTTCCGTCGCCTACCACGCCAAGCCATCGGGTGAAGACATCACGTCCAAGGCTAAGAAC
ATGGGCATGCAGCTCGTCTTCTATCTCGGTGTCAAGGGCCTCTTCGGCGTTCCGCTGCCCGTCTGGGTCGAGCTG
GTTGGGCTCGTGGCGACAGCTCGTGTGCGGCTGCAATTGACGCCCGATCCGCCGTTCCTCAAGACGCTCAGCGTC
ACGCTCATGGGCGTCCCCAAGGTACAAGCCGGGTGCACGCCCATGATCGAAAAGGGCGTCAACGTCCTGAACCTG
CCGCTCATCTCCAACTTTGTCAACTGGGCCATACGCACGGCCGCGTCAATGTACGTGGCGCCGAAGAGCTTGACG
TTGGATATGAGCAAGATGCTTGCGGGGGACGACATCAAGAAGGAGACGCAGGCCCTGGGTGTCGTATTCATTCGC
ATCCACAAGGCAACTGGCCTCAGCAAGCAGGATCACTCGGGCAGCCGCGGCGGCGGCTCGGATCCGTACATCACC
GTCAGCTGGAGCAAGTTCTCCAAGCCACAGTTCTGCACGCGCGTCATCCAGGATGACCTGAACCCAGTCTTTGAA
GAGACTTGCGGCCTCTTGGTCACGAGCGACCTGATCAAGGCCGACGAGAAGCTCTCGATGGAGCTCTGGGACAGC
GATCGCTCTTCGGCAGATGACGTCGTGGGCAAGGTCGAACTCAGCATCCAGAAGCTCATTCAGCACCCAGGCAAG
ATGTTCCCCCAGGTGTCCCATCTCTGCGGCGTCAAGGCCGACAGCAGCATGCCTGGTCAGCTCCACTGGGAGGTA
GGCTTTTTCGGCAAGACGCAGTTCCGTAAAGCCCTGCGAACCGATGGCCGCGACGCCACCCTCCCCAAAGCGTTG
GCCGATAAGCCTGAGCTCCAGGACCAGAGAGGCAGCATCGACTCCAAGGAGGAGGATGCCGTGGTCCACACGCCG
CCCGACCCTCTCTGGCCATCGGGCATCCTCAGCATCGTCGTCCATCAGATCGTGGGCCTGGAGCTTGCCAATATC
AAGGGCTCCGACGGGAAGCGCAAGGGCAAGGAGTACGAGCCGGCGCGGCCCGAGGCAGGCGAGGTCAAGGAGGAG
CAGGGCCAGAAGCTTCCGAGTTCCTACTGCACCGTCTTGCTTAACGATAGTTTGGTGTACAAGACGCGCATCAAG
GCCGTGTCGTCACAGCCCATCTTTAACGCCGGGACCGAGAAGTTTGTCCGCGACTGGAGGTCCTGCATCGCTACC
ATAGCCGTCCGCGACTCGCGGAACAGGCAGCACGACCCTATCATCGGGGTGGTGCCTCTGCAGCTGTCGGACGTG
CTGCGGACGAGCAGCCAGGTGACTCGATGGTATCCTCTCGATGGCGGCATCGGGTTCGGCCGCATCCGCATCTCT
ATCCTCTTCCGTTCGGTTGAGCTCCGTCTGCCCCCGCCGCAGCTCGGCTGGGACATTGGCACGTTTGAGTTCACG
TCGGACAGCATCACCACGACGGGTTACGCACCGTCTCAGAGCGTCAAGCTGAAACTGCGCACGGGCGGATCGTCT
GCCACGGTCAAGAAGAGCTTTTCCATCAGGGAGGAGACCGGGATGCGGATAGACATCAGCGGCGGGGAAGACGGA
AAGGGAATGCGACTCCCCGTCCGTCACCGGTATCGATGCCCCATCTTCCTCGAGTTTTACTCGACAAGCAGTCGC
AAGCCCGATGCCTACGCTGCTCTTTGGCTGCTAGAGCTCAGCGACGGGGAAGATGAGGATTTTGACGTTCCCATC
TTTACGTGTAGCAACGGCCTGCGCCTCTCGCAAAACTACATCACCCAAGAAAACTACCAGGAAATTCCCGACCTC
GAGATTGAAGAGGTTGGCCGCGCACGGTTCCGGGGTCGCTTCTCCCCGGGCACCGACTCGGACCACATGAAGTTT
GTGTGCGACAACGACTCCCGCGAGACGATTGAGACGTGGGAGGCCTGCTATGCCGAGGGCGTGCGGAAGCAGGAG
GTGAAGGCCGAGGTGCCTCCGCTGGTGATGGAGTTGCACGACCAGTCCTTGACGCATGGCCGAGACGTGCTCGCC
CAGGCCAACGAAGACGACAAGCAGCGGTGGCTGGCCAAGGACGGCACGGACTGGAGCGGTGCCTTTGGCAAGGAC
CCCAGGGATCTGATGGCGAGCAAGTCGGACGGGGGCCAAGGTCAGGACGGTGCTGGGGAGGATTACGACGACAGC
AGTTCCAGCGATAGCGACCCCGATCTCGGCATCGAGGAGCACCCGGACGCTTCGGGTGACAAGGCCGACCAAGGC
AGGCCGTCGACGGACTCCAAGAATGAGTCGTCGTCGTCGTCTTCGTCGTCGTCTTCGCCCGGCGGCGGAAGCAGC
AAGAACCCGTACACCATGTACAAGAACTACACGGCGCGCAACCGCGACTTGCACCGGAAGCACCGCGGGTTGATG
CAGTGGCGACCGATCCGCAACGCGCAATTCGCCAAGGACGAGGCCAAGTTTGCGCTGCGTAAGGTGAAGAATCTG
GGGGGTTTGGGAGGACGACAGCCGGATGTGGAGACTGAGGTTTAG
Gene >Ophio5|1607
ATGCGCATGGACGTTGCGAGCCAAGAGGTGGCCGATGCCGAGGCCGACGCCATCGCTCCCGAGCAGTATCAACAG
CGCAATAGCGATGAGATTGAGCGTATCGTGTCCGTCTCGACGGCCACGACAGCGTCTTCGATGGGTCCCAGCACT
ACGCACGGCATGCGCCACCGAATGAGCTACGTCTCGACACATCGCGACCTCGAGCGTCACTACACCGAGCTGAGC
CGCATCGAGACGCAACGGACTCAGCACATTGGTACGGTGGGAAGCGCCGGCGGCAGTGTCCGGGAAAATCGCAAG
CCTCTTCCGTCTTTCGGCGCCGGCAAGCCTTTTCCTCCGCCGCTGCCGGCCCGTGACGAGTATGTGGTCGAATTT
GACGGCCCCGACGACCCTCTCAACGCCCAGAACTGGCCGACGCACACCAAGATCATCATGGCCGCTATGATGTCG
TTTACAACCTTTGTCTCGTCCTTTACCTCGTCCATCTACTCACCCGCCATTGCCACCATCTCCCAATACTTCCAC
GTTGACAGCGAGGTCGCCCTGCTCGGCACGACGCTCTACGTCCTGGGCTTCGCCTTCGGCCCCTCGCTGTGGGCT
CCCCTCTCGGAACTGCGTGGCCGCCGACTGCCCATTAACCTCTCCATGTTTGGCTTCTCCGTCTTCTGCATTGGC
GCAGCCACGGCCAAGGATATTCAGACACTCCTCATCTGTCGCTTCTTTAGCGGCTTCTTCGGCTCCTGCTCGCTC
GCCGTCGTCGCCGCCATCTTCTCCGACATGTTCAACAACGTGACGCGCGGCATCGCCATCACCTTCTTCACCATG
ACCGTCTTCACGGGGCCGCTCCTCGCCCCCTTCATCGGCGGCTTCATCGTCGAGTCGTACCTCGGCTGGCGATGG
ACCTTGTATCTGCCCACTATCTTGGGCTTCGCCGCCTTTTTCCTCGACTTCTTCTTTCTCAAGGAGTCGTATGCG
CCCGTCATCCTCGTCGAAAAGGCGGGCGAATTGCGGCGCCGCACTCGCAACTGGGGCATCCACGCCAAGCAGGAA
GAAATCGAAATCGACTTCGCCGAGCTCGTCAACAAGAACTTTGCCCGGCCCATGCGTATGCTCTTTACCGAGCCC
ATCCTCTTCTTCCTCACCCTTTACATGAGCTTCATGTACGGCCTACTCTATCTCTTCCTCACCGCCTACAACCTA
GTCTTTGTCGGAATCCACCACTTCAGCCTAGGCGACGCCGGCCTGACGTTTTTCGGCATGGTCATCGGCGTCTTC
ATTGCCGGCATCGTCGTCCTCGCCCAGCAGCCGTGGTACAAGCGCAAGCTGGCCAGCAACAACGGCGTTCCGGTG
CCTGAATGGCGGCTGCCCAGCGTCATGGCCGGCGGCGTCTGTTTCGTCATTGGCATCTTTTGGTTCGGATGGTAA
GTCTTCTTTTTTTTTCTTTTTTTTTTCGAGTTTCCACCGTCTGGTCTACCACTCCCTCCCCCCCCCCCCTTCTCT
CCGCCGCCCAGATTGCTCACTCGCCGTGCAGGACTGGATACAAAGCTGACATTCCCTGGATCGCGCCCGCGGCCA
GCGGCATCTTCACCGGCTTCGGACTCATGTCCATCTTTCTGCAGGCCATCAACTACATCGTCGACGCCTACCTCA
TGTTTGCCGCTTCGGCCCTCGCTGGCAACACCTTTATGCGATCTCTCGCAGGCGCCACCTTTCCGCTCTTTGCGA
GGCAGATGTTCGTGGGCATGGGAATTCAGTGGGCGTCGACGCTTCTGGGCTGCTTGGCCCTGCTGATGTGTCCGA
TCCCGTTCGTCTTCTACAAGTACGGCCGCAAGCTCCGGGAGAAGAGCAAGTTCGCCCCGACGCCGCCCAGACCGG
CGCCCTCACACTCGTCCGAAGAGGTCGGCAACGGCGAGACGGTGACGGAGAAGAAGAAGCGAGATCACTCTACGG
CCAGTCGCGACACGGCGGTGCTGAGTACGGACTCGGCGTCGGCGGCGGCGCTGGGGAGCGTGCGGTCAAGGGACA
GCGACAACGTGGGTCCCATGATGAACGTATAGCGAGGTGTCGTCCTGGGAGCATGGCGTTTCGGGGCCTGCTTTT
TTCTCTCTGTTTTCCTGACTTTCAAGCATCAAAAAAGCGTCTCGGCGTTGGGGAGGGTGTTTTATCTCGTAGCCA
TGGCAATGGGCAAAGCGGACATGACGGAAAAACGATACCAAGCTAATAATAGGGTAAACAAGAGGTGGGAAGAAG
CAAAAAAGGGGATCAAGAAGGTTGGTTGTATATACATACATGAGGCCCCCAAGGGAGGGGGAGGGGGTTTGAAGA
AGTGCAGAAGCACGTTGTTGCAAGATGTAGAGTGTTCGACGAGTCTAGACCATGCGTGCGGAAGAAAGAATTGCC
GAACAAGGTGCCACGAAATTAGCGATTGTGCTGTGGTAAATGATCGGTGATACGCCTACCCGAAGCGCTCGTATA
CATACAGGTAGTTAGACAGGTAGTTAGTTAGTAGGCCTTCATCCTTCCGCGTCGCTGCAAATCGACACGGCTCGA
ATCGGATCTATAGGTGGGATCGACGCGAGCATTTTCAGCTCCAGACAGCTGGAGCTATTGGCCCCGGGGTGGGGG
ACTACGAGCTCACACTGTACGGCACCAGATCAAGGGACGCTGCAGAATGCGACCGTACTGTGCTTCGGATCCGAG
TCAGCACTTAGCTACGTCATCGGCCGCCGCAGCTTCATAATGATGTGACTCTCCAGGCGAGTGCCGACAATGATG
ATGGGCTGGTCCAAATGACGTAGCCTGCAGCTGCCGATCCCGGGACAAATACATACATAGGTAGGTAGGTATAGG
TTGGTTGGTTGGTTGGCTTGGGGGCAGTCCAGACCGACCGACCCAATCTTGCCTTGTTGTGATGGTGTTATTCCA
CCTCCTCTCACCTCACCTCACCCCGTCTTCCTCTTCCACCTAATAACGCCCACAACAGACACACGCATCCCGCCT
TTGTCCAAGCCTCAATTGAAACACTCGTGGGCTCTCTACGAGTACGAGAAGCCGGTCCTCTACTTCTGTCACGAC
GCACGACAAGGCTGCCGGATGGACGTTGAAGAGCATGTGGCGCCCTCGGGCCAGCACTACAGCGGACGCAACCGC
ATCCCCAACATCAAGCAGTTCGCCGAGCAGCTCGACCTGGAGAAGCGAAATCGCGATGCCGTGATCGACGCCGAG
CTTCACAAGAATAGCGAGGGGCGGGAGCATCAGACGGCACAAAAGAGCAGGCGTGACAACACACGCACCGTTCGC
GATCCAGTAACTGGTAAGGATGTCGGCATCCGCGACGCCGATGCCGACTACAAGGCGGCCGTCGACGACCCTCAA
GTGTGTGCTCCCCCAATGCCCGCCCTCACGACCTTGATCAGAGCTGACAAACGCCGCTAGCTGTCCGTCCCCAAC
GAAAACCTCGGCAGGCCTACCACGGTGAGAGTGTCGTCGCAACAGTCCGGCGAGGAGTACCGCCGCAACCAGGAC
ATCACGGCACCCCCCGCCCCGGTTCAGGAAGGGGCCACATCGGACGTACCCATCAGCAGCGAGAAGACGTCGATT
CTGTTTTACAAGACGCCGTCGGTCAGCTACGAGCCCATGTTTGCCGCCCTCGAGCGCAAGGCCACTGTCTTATGC
TTTGGTATTTTCATTGCCATCATCTTCATGGGCAAAATGTTTGGCGGCAGGCTCCTCGGCCTCGTCCCCCTGGCT
GGCTGCGTCGCCTCGGGCGTCTTCCTCTGGGCCAAGGATATCGTCCGTCAGGGCAGGGATATGGAGTGGTCGAGC
GAGCAGCAGCGCGGTGAGACTGCTACCGCCAACTTGATTCCCGAGTCTGTGGAGTGGATGAACACGGCCATTGGC
ATTGTCTGGGGCCTCATCAATCCCGAAATGTTTGCCTCTGTCGCCGATACGTGAGTATGCCCTGTCAGTATCGGC
CGATCAGAGAGCGCTGACAGCATAGGGAAGCCTGGAGGACGTCATGGTTGCGTCGGTGCCGGGCGTCATTGAAAA
CGTCCGCGTCGCCGACATATCCCAGGGCAGCAACCCTCTTCGAATCCTTAGCATAAGAGCTTTGCCAGACTCTCA
CGTCAAAGACATTAAGCAGGAGATACATCGAGACAACGAAAAGACCATGGATCCCAACGAACTGGCAGCCGTCGA
GCAGGCCGGCTCCTTTTACAACATGGAGGTTTCCGTCGCCTACCACGCCAAGCCATCGGGTGAAGACATCACGTC
CAAGGCTAAGAACATGGGCATGCAGCTCGTCTTCTATCTCGGTGTCAAGGGCCTCTTCGGCGTTCCGCTGCCCGT
CTGGGTCGAGCTGGTTGGGCTCGTGGCGACAGCTCGTGTGCGGCTGCAATTGACGCCCGATCCGCCGTTCCTCAA
GACGCTCAGCGTCACGCTCATGGGCGTCCCCAAGGTACAAGCCGGGTGCACGCCCATGATCGAAAAGGGCGTCAA
CGTCCTGAACCTGCCGCTCATCTCCAACTTTGTCAACTGGGCCATACGCACGGCCGCGTCAATGTACGTGGCGCC
GAAGAGCTTGACGTTGGATATGAGCAAGATGCTTGCGGGGGACGACATCAAGAAGGAGACGCAGGCCCTGGGTGT
CGTATTCATTCGCATCCACAAGGCAACTGGCCTCAGCAAGCAGGATCACTCGGGCAGCCGCGGCGGCGGCTCGGA
TCCGTACATCACCGTCAGCTGGAGCAAGTTCTCCAAGCCACAGTTCTGCACGCGCGTCATCCAGGATGACCTGAA
CCCAGTCTTTGAAGAGACTTGCGGCCTCTTGGTCACGAGCGACCTGATCAAGGCCGACGAGAAGCTCTCGATGGA
GCTCTGGGACAGCGATCGCTCTTCGGCAGATGACGTCGTGGGCAAGGTCGAACTCAGCATCCAGAAGCTCATTCA
GCACCCAGGCAAGATGTTCCCCCAGGTGTCCCATCTCTGCGGCGTCAAGGCCGACAGCAGCATGCCTGGTCAGCT
CCACTGGGAGGTAGGCTTTTTCGGCAAGACGCAGTTCCGTAAAGCCCTGCGAACCGATGGCCGCGACGCCACCCT
CCCCAAAGCGTTGGCCGATAAGCCTGAGCTCCAGGACCAGAGAGGCAGCATCGACTCCAAGGAGGAGGATGCCGT
GGTCCACACGCCGCCCGACCCTCTCTGGCCATCGGGCATCCTCAGCATCGTCGTCCATCAGATCGTGGGCCTGGA
GCTTGCCAATATCAAGGGCTCCGACGGGAAGCGCAAGGGCAAGGAGTACGAGCCGGCGCGGCCCGAGGCAGGCGA
GGTCAAGGAGGAGCAGGGCCAGAAGCTTCCGAGTTCCTACTGCACCGTCTTGCTTAACGATAGTTTGGTGTACAA
GACGCGCATCAAGGCCGTGTCGTCACAGCCCATCTTTAACGCCGGGACCGAGAAGTTTGTCCGCGACTGGAGGTC
CTGCATCGCTACCATAGCCGTCCGCGACTCGCGGAACAGGCAGCACGACCCTATCATCGGGGTGGTGCCTCTGCA
GCTGTCGGACGTGCTGCGGACGAGCAGCCAGGTGACTCGATGGTATCCTCTCGATGGCGGCATCGGGTTCGGCCG
CATCCGCATCTCTATCCTCTTCCGTTCGGTTGAGCTCCGTCTGCCCCCGCCGCAGCTCGGCTGGGACATTGGCAC
GTTTGAGTTCACGTCGGACAGCATCACCACGACGGGTTACGCACCGTCTCAGAGCGTCAAGCTGAAACTGCGCAC
GGGCGGATCGTCTGCCACGGTCAAGAAGAGCTTTTCCATCAGGGAGGAGACCGGGATGCGGATAGACATCAGCGG
CGGGGAAGACGGAAAGGGAATGCGACTCCCCGTCCGTCACCGGTATCGATGCCCCATCTTCCTCGAGTTTTACTC
GACAAGCAGTCGCAAGCCCGATGCCTACGCTGCTCTTTGGCTGCTAGAGCTCAGCGACGGGGAAGATGAGGATTT
TGACGTTCCCATCTTTACGTGTAGCAACGGCCTGCGCCTCTCGCAAAACTACATCACCCAAGAAAACTACCAGGA
AATTCCCGACCTCGAGATTGAAGAGGTTGGCCGCGCACGGTTCCGGGGTCGCTTCTCCCCGGGCACCGACTCGGA
CCACATGAAGTTTGTGTGCGACAACGACTCCCGCGAGACGATTGAGACGTGGGAGGCCTGCTATGCCGAGGGCGT
GCGGAAGCAGGAGGTGAAGGCCGAGGTGCCTCCGCTGGTGATGGAGTTGCACGACCAGTCCTTGACGCATGGCCG
AGACGTGCTCGCCCAGGCCAACGAAGACGACAAGCAGCGGTGGCTGGCCAAGGACGGCACGGACTGGAGCGGTGC
CTTTGGCAAGGACCCCAGGGATCTGATGGCGAGCAAGTCGGACGGGGGCCAAGGTCAGGACGGTGCTGGGGAGGA
TTACGACGACAGCAGTTCCAGCGATAGCGACCCCGATCTCGGCATCGAGGAGCACCCGGACGCTTCGGGTGACAA
GGCCGACCAAGGCAGGCCGTCGACGGACTCCAAGAATGAGTCGTCGTCGTCGTCTTCGTCGTCGTCTTCGCCCGG
CGGCGGAAGCAGCAAGAACCCGTACACCATGTACAAGAACTACACGGCGCGCAACCGCGACTTGCACCGGAAGCA
CCGCGGGTTGATGCAGTGGCGACCGATCCGCAACGCGCAATTCGCCAAGGACGAGGCCAAGTTTGCGCTGCGTAA
GGTGAAGAATCTGGGGGGTTTGGGAGGACGACAGCCGGATGTGGAGACTGAGGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail