Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|16
Gene name
Locationscaffold_1:34367..35747
Strand-
Gene length (bp)1380
Transcript length (bp)1197
Coding sequence length (bp)1194
Protein length (aa) 398

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00002 7tm_2 7 transmembrane receptor (Secretin family) 3.1E-12 18 203
PF05462 Dicty_CAR Slime mold cyclic AMP receptor 9.5E-06 28 191

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q54U75|CRLA_DICDI Cyclic AMP receptor-like protein A OS=Dictyostelium discoideum GN=crlA PE=2 SV=1 3 208 1.0E-09

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0007186 G protein-coupled receptor signaling pathway Yes
GO:0004930 G protein-coupled receptor activity Yes
GO:0007165 signal transduction No
GO:0060089 molecular transducer activity No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0065007 biological regulation No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0004888 transmembrane signaling receptor activity No
GO:0038023 signaling receptor activity No
GO:0050794 regulation of cellular process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 49 71 22
3 99 116 17
4 125 147 22
5 178 200 22
6 337 356 19
7 371 393 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|16
MPRHSRNPGLTSAEIDSLLTIERTGAGLSMVAISLIALTFIVFKKLRTTPNLFLLVASLANAGASVASMMGHDGL
RKGEASSLCQAQAFIFEWFMQSDPWWSFAMAINVFLVFFNNADPCSFRRYLWVYCLVCFGGPFIPAVVLISITGD
HRGPIYGDAVLWCWISDNWSLVRLYAYYIPIWLCILLSFVIYFAVGIHVFHRRNQLMSISMPEKGQQKPVRFGRS
GCDSAEESLTRRQDAYGTVVTEVHITSSLPPLDFDLPTAPTYSHPRGGLPGSSSWTSGLHGESSVVRNNHHQFET
ICSSDTTRPKKRSCFGVVKAVLAEASLKLKRLDPVKMAYLRTSFIFGLSILITWIPSSVNRLYSLANGGRISFGL
SVASGCVLPLQGVWNAIIYLTTS
Coding >Ophio5|16
ATGCCGCGCCATTCAAGAAACCCAGGTCTCACCTCGGCCGAGATTGACAGCCTCCTCACCATCGAGCGCACCGGT
GCCGGCCTCTCCATGGTCGCCATCAGCCTGATTGCCTTGACCTTCATCGTCTTCAAGAAGCTTCGCACCACGCCG
AACCTTTTCCTTCTCGTCGCCTCCCTTGCCAATGCCGGGGCCAGTGTCGCCTCCATGATGGGCCATGATGGCCTT
CGTAAGGGCGAAGCCTCTTCTCTCTGTCAAGCCCAGGCCTTCATCTTCGAGTGGTTCATGCAGTCGGATCCCTGG
TGGTCCTTTGCCATGGCTATCAACGTCTTTCTCGTCTTTTTCAATAACGCAGATCCTTGTTCGTTCCGACGATAT
CTCTGGGTTTATTGTCTCGTCTGTTTTGGCGGTCCCTTCATCCCTGCAGTCGTCCTCATCTCCATCACCGGCGAC
CATCGTGGCCCCATCTACGGCGACGCTGTGCTATGGTGCTGGATCAGCGATAATTGGAGTCTCGTCCGGCTGTAT
GCCTATTACATTCCAATCTGGCTTTGCATCTTGTTGTCCTTCGTCATCTACTTTGCCGTCGGCATTCATGTCTTC
CATCGCCGGAATCAGTTGATGAGCATTTCCATGCCCGAAAAGGGCCAGCAGAAACCAGTCAGATTTGGCCGAAGT
GGCTGCGACTCTGCTGAGGAGAGCCTCACACGACGCCAAGACGCCTACGGAACCGTCGTGACCGAGGTTCACATC
ACGTCCTCACTGCCGCCCCTCGACTTCGACCTGCCCACGGCACCGACCTATTCGCATCCCCGGGGCGGCCTCCCG
GGAAGTTCTTCTTGGACTTCAGGCCTTCACGGTGAGAGCTCAGTTGTTCGCAACAATCATCATCAGTTTGAGACC
ATCTGCTCGTCCGACACCACTCGACCCAAGAAACGCAGCTGCTTCGGCGTCGTCAAGGCCGTTCTAGCGGAAGCG
TCTCTGAAGCTGAAGCGCCTGGACCCAGTCAAGATGGCCTATCTACGCACCAGCTTCATCTTCGGCCTTTCCATC
CTCATCACCTGGATCCCGAGCTCCGTCAACAGGCTGTACAGTCTGGCCAATGGGGGCCGCATCAGCTTCGGTCTC
AGTGTCGCCAGTGGCTGCGTGCTTCCGCTGCAGGGGGTCTGGAACGCCATTATCTACCTCACGACAAGC
Transcript >Ophio5|16
ATGCCGCGCCATTCAAGAAACCCAGGTCTCACCTCGGCCGAGATTGACAGCCTCCTCACCATCGAGCGCACCGGT
GCCGGCCTCTCCATGGTCGCCATCAGCCTGATTGCCTTGACCTTCATCGTCTTCAAGAAGCTTCGCACCACGCCG
AACCTTTTCCTTCTCGTCGCCTCCCTTGCCAATGCCGGGGCCAGTGTCGCCTCCATGATGGGCCATGATGGCCTT
CGTAAGGGCGAAGCCTCTTCTCTCTGTCAAGCCCAGGCCTTCATCTTCGAGTGGTTCATGCAGTCGGATCCCTGG
TGGTCCTTTGCCATGGCTATCAACGTCTTTCTCGTCTTTTTCAATAACGCAGATCCTTGTTCGTTCCGACGATAT
CTCTGGGTTTATTGTCTCGTCTGTTTTGGCGGTCCCTTCATCCCTGCAGTCGTCCTCATCTCCATCACCGGCGAC
CATCGTGGCCCCATCTACGGCGACGCTGTGCTATGGTGCTGGATCAGCGATAATTGGAGTCTCGTCCGGCTGTAT
GCCTATTACATTCCAATCTGGCTTTGCATCTTGTTGTCCTTCGTCATCTACTTTGCCGTCGGCATTCATGTCTTC
CATCGCCGGAATCAGTTGATGAGCATTTCCATGCCCGAAAAGGGCCAGCAGAAACCAGTCAGATTTGGCCGAAGT
GGCTGCGACTCTGCTGAGGAGAGCCTCACACGACGCCAAGACGCCTACGGAACCGTCGTGACCGAGGTTCACATC
ACGTCCTCACTGCCGCCCCTCGACTTCGACCTGCCCACGGCACCGACCTATTCGCATCCCCGGGGCGGCCTCCCG
GGAAGTTCTTCTTGGACTTCAGGCCTTCACGGTGAGAGCTCAGTTGTTCGCAACAATCATCATCAGTTTGAGACC
ATCTGCTCGTCCGACACCACTCGACCCAAGAAACGCAGCTGCTTCGGCGTCGTCAAGGCCGTTCTAGCGGAAGCG
TCTCTGAAGCTGAAGCGCCTGGACCCAGTCAAGATGGCCTATCTACGCACCAGCTTCATCTTCGGCCTTTCCATC
CTCATCACCTGGATCCCGAGCTCCGTCAACAGGCTGTACAGTCTGGCCAATGGGGGCCGCATCAGCTTCGGTCTC
AGTGTCGCCAGTGGCTGCGTGCTTCCGCTGCAGGGGGTCTGGAACGCCATTATCTACCTCACGACAAGCTAG
Gene >Ophio5|16
ATGCCGCGCCATTCAAGAAACCCAGGTCTCACCTCGGCCGAGATTGACAGCCTCCTCACCATCGAGCGCACCGGT
GCCGGCCTCTCCATGGTCGCCATCAGCCTGATTGCCTTGACCTTCATCGTCTTCAAGAAGCTTCGCACCACGCCG
AACCTTTTCCTTCTCGTCGCCTCCCTTGCCAATGCCGGGGCCAGTGTCGCCTCCATGATGGGCCATGATGGCCTT
CGTAAGGGCGAAGCCTCTTCTCTCTGTCAAGCCCAGGCCTTCATCTTCGAGTGGTATGTTTCCACCCCAACCCCC
TTCCCCTGCAGAGCTCTGTTTACCAAGGGACGCTATCAGGTTCATGCAGTCGGATCCCTGGTGGTCCTTTGCCAT
GGCTATCAACGTCTTTCTCGTCTTTTTCAATAACGCAGATCCTTGTTCGTTCCGACGATATCTCTGGGTTTATTG
TCTCGTCTGTTTTGGCGGTCCCTTCATCCCTGCAGTCGTCCTCATCTCCATCACCGGCGACCATCGTGGCCCCAT
CTACGGCGACGCTGTGGTAAGTCATCATTCATCCCTCATCCCTCAGTCTTCGTCCACACTCGGCTCACGCTCCCA
TAGCTATGGTGCTGGATCAGCGATAATTGGAGTCTCGTCCGGCTGTATGCCTATTACATTCCAATCTGGCTTTGC
ATCTTGTTGTCCTTCGTCATCTACTTTGCCGTCGGCATTCATGTCTTCCATCGCCGGAATCAGTTGATGAGCATT
TCCATGCCCGAAAAGGGCCAGCAGAAACCAGTCAGATTTGGCCGAAGTGGCTGCGACTCTGCTGAGGAGGCACGC
AGTTCCTCTGTCCCGTCTATACTCGCTATAATGCGTTCTAACACCATCTGGCAGAGCCTCACACGACGCCAAGAC
GCCTACGGAACCGTCGTGACCGAGGTTCACATCACGTCCTCACTGCCGCCCCTCGACTTCGACCTGCCCACGGCA
CCGACCTATTCGCATCCCCGGGGCGGCCTCCCGGGAAGTTCTTCTTGGACTTCAGGCCTTCACGGTGAGAGCTCA
GTTGTTCGCAACAATCATCATCAGTTTGAGACCATCTGCTCGTCCGACACCACTCGACCCAAGAAACGCAGCTGC
TTCGGCGTCGTCAAGGCCGTTCTAGCGGAAGCGTCTCTGAAGCTGAAGCGCCTGGACCCAGTCAAGATGGCCTAT
CTACGCACCAGCTTCATCTTCGGCCTTTCCATCCTCATCACCTGGATCCCGAGCTCCGTCAACAGGCTGTACAGT
CTGGCCAATGGGGGCCGCATCAGCTTCGGTCTCAGTGTCGCCAGTGGCTGCGTGCTTCCGCTGCAGGGGGTCTGG
AACGCCATTATCTACCTCACGACAAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail