Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1598
Gene name
Locationscaffold_158:24202..26713
Strand+
Gene length (bp)2511
Transcript length (bp)2451
Coding sequence length (bp)2448
Protein length (aa) 816

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13855 LRR_8 Leucine rich repeat 4.8E-09 443 501

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUG2|YFT6_SCHPO Uncharacterized leucine-rich repeat-containing protein C926.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC926.06c PE=1 SV=1 2 776 1.0E-68
sp|Q8CDN9|LRRC9_MOUSE Leucine-rich repeat-containing protein 9 OS=Mus musculus GN=Lrrc9 PE=1 SV=2 443 586 9.0E-12
sp|Q6AYH9|DAAF1_RAT Dynein assembly factor 1, axonemal OS=Rattus norvegicus GN=Dnaaf1 PE=1 SV=1 413 579 1.0E-10
sp|Q9D2H9|DAAF1_MOUSE Dynein assembly factor 1, axonemal OS=Mus musculus GN=Dnaaf1 PE=1 SV=1 413 579 1.0E-10
sp|Q8NEP3|DAAF1_HUMAN Dynein assembly factor 1, axonemal OS=Homo sapiens GN=DNAAF1 PE=1 SV=5 413 579 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUG2|YFT6_SCHPO Uncharacterized leucine-rich repeat-containing protein C926.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC926.06c PE=1 SV=1 2 776 1.0E-68
sp|Q8CDN9|LRRC9_MOUSE Leucine-rich repeat-containing protein 9 OS=Mus musculus GN=Lrrc9 PE=1 SV=2 443 586 9.0E-12
sp|Q6AYH9|DAAF1_RAT Dynein assembly factor 1, axonemal OS=Rattus norvegicus GN=Dnaaf1 PE=1 SV=1 413 579 1.0E-10
sp|Q9D2H9|DAAF1_MOUSE Dynein assembly factor 1, axonemal OS=Mus musculus GN=Dnaaf1 PE=1 SV=1 413 579 1.0E-10
sp|Q8NEP3|DAAF1_HUMAN Dynein assembly factor 1, axonemal OS=Homo sapiens GN=DNAAF1 PE=1 SV=5 413 579 1.0E-10
sp|B6D5P6|DAAF1_PERCA Dynein assembly factor 1, axonemal OS=Peromyscus californicus GN=Dnaaf1 PE=2 SV=1 413 579 2.0E-10
sp|Q5F479|S11IP_CHICK Serine/threonine-protein kinase 11-interacting protein OS=Gallus gallus GN=STK11IP PE=2 SV=1 440 579 2.0E-10
sp|Q6ZRR7|LRRC9_HUMAN Leucine-rich repeat-containing protein 9 OS=Homo sapiens GN=LRRC9 PE=2 SV=2 443 586 3.0E-10
sp|B6D5P3|DAAF1_PERLE Dynein assembly factor 1, axonemal OS=Peromyscus leucopus GN=Dnaaf1 PE=2 SV=1 413 579 3.0E-10
sp|B6D5P1|DAAF1_PERPL Dynein assembly factor 1, axonemal OS=Peromyscus polionotus GN=Dnaaf1 PE=2 SV=1 413 579 4.0E-10
sp|Q3SYS4|DAAF1_BOVIN Dynein assembly factor 1, axonemal OS=Bos taurus GN=DNAAF1 PE=2 SV=2 413 583 4.0E-10
sp|Q6IRN0|S11IP_XENLA Serine/threonine-protein kinase 11-interacting protein OS=Xenopus laevis GN=stk11ip PE=2 SV=1 440 572 2.0E-09
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 443 573 7.0E-09
sp|Q6P4K6|S11IP_XENTR Serine/threonine-protein kinase 11-interacting protein OS=Xenopus tropicalis GN=stk11ip PE=2 SV=1 440 572 3.0E-08
sp|Q9Y2I1|NISCH_HUMAN Nischarin OS=Homo sapiens GN=NISCH PE=1 SV=3 412 573 4.0E-08
sp|Q09JZ4|DAAF1_CHLRE Leucine-rich repeat-containing protein ODA7 OS=Chlamydomonas reinhardtii GN=ODA7 PE=1 SV=1 443 614 4.0E-08
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 443 573 8.0E-08
sp|Q8N1F8|S11IP_HUMAN Serine/threonine-protein kinase 11-interacting protein OS=Homo sapiens GN=STK11IP PE=1 SV=3 440 579 1.0E-07
sp|Q80TM9|NISCH_MOUSE Nischarin OS=Mus musculus GN=Nisch PE=1 SV=2 412 573 3.0E-07
sp|Q4G017|NISCH_RAT Nischarin OS=Rattus norvegicus GN=Nisch PE=2 SV=2 412 573 4.0E-07
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 441 578 1.0E-06
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 431 572 2.0E-06
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 443 570 3.0E-06
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 443 570 3.0E-06
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 439 572 5.0E-06
sp|P0DM44|LGR6_DANRE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Danio rerio GN=lgr6 PE=2 SV=1 441 571 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6305 0.2703 0.1522 0.2129 0.0648 0.0034 0.204 0.1849 0.3081 0.0127

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2487
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6227
Ophiocordyceps australis map64 (Brazil) OphauB2|4091
Ophiocordyceps camponoti-floridani Ophcf2|04489
Ophiocordyceps camponoti-rufipedis Ophun1|972
Ophiocordyceps kimflemingae Ophio5|1598 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3595

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1598
MSSEDGDYFIKRLVTFVRTHEKSIANALQFQRREVRHRSSQSTGSATLSLSPTLPERPSTSSVPNSLAAALSFGS
INFTSHNAKSVRLALTPHHLFFLLSRFEELNIQVGPMKVRLEDLHDSSSTIYVSFLGNTGRSRSRSSDVGSIHSV
SSMRSVMSGMSALWTSFGIGASISAARTERHKAAIQADLKYLYSAFTKIPCLRLAPDWRARMIKGYEEFPFDSAV
PLYVFKNLQALEIRNLDFRQFFGWDRLADQLRSLSLRRAGIEDPADILIDIVLDDMDKRRRRSSKSQASPTATLV
ANSSPRRSPTIPHLELVRAASAPGSPDTRSALADLRVGSMTPSDPAVEDTDASDAGRTPVARDDADGHRRSPTRR
ARPRSNSPTRPASSRNYSSNIRSSQRIRRSGSGSSHSSMSDSWHYHARGSSGNLLAMGVLPSTKWRFLRHLSLAD
NALTSIPQASLAPLSNTLRSLDLSSNLFSQIPDSLATLTALRALNLSNCMIDSLHSLTRSPLPAMTALNLRANRL
RSLAGVEKLCPLERLDLRDNQLTDPRELARLTGMPDLREIWVEGNPFTRTHKNHHVIIFNLFRSTPGYTVDLIID
GRGPSYSERRQLVERAPIPDSVPVVKPKAPDAPAVVDVGKAVPSEASVGSARRRNKASKRRIVDLASGDVSLPPL
AVDTGAQTAEDATKVDVSEVSPSDGYRTSRPTESVLLPPVRLSPSGESGGAGRRAADVGSGLPADADPQDWDVSG
EIYRRRIQNLRDRVGSGYLSVLSEESWDGTGSFNAAGSTSIPPLRAGHLSSNTLSAQAVHSGPTMG
Coding >Ophio5|1598
ATGAGTTCCGAAGACGGAGACTACTTCATCAAGCGCCTGGTCACATTCGTTCGGACGCACGAGAAATCCATAGCC
AATGCGCTCCAGTTCCAGCGCCGCGAGGTCCGTCACAGGTCCTCTCAAAGCACCGGCTCGGCCACGCTGTCCCTG
TCTCCCACTCTACCGGAGCGACCCTCGACGTCTTCGGTGCCGAATTCTCTCGCTGCTGCCTTATCCTTTGGATCC
ATCAACTTCACCTCGCACAATGCCAAGTCGGTGAGGCTGGCCCTGACGCCCCACCACCTGTTCTTCCTCCTCTCC
CGCTTTGAGGAGCTCAACATCCAGGTCGGGCCCATGAAAGTGCGCCTTGAAGACCTCCACGACAGCTCATCGACC
ATCTATGTCTCCTTTCTCGGAAACACAGGCCGGTCTCGGAGTCGCAGCTCTGATGTTGGCTCCATCCATTCTGTG
TCCAGCATGCGGAGCGTCATGTCGGGCATGTCGGCTCTCTGGACGAGCTTCGGCATCGGCGCCAGCATTTCTGCG
GCCAGAACCGAGCGCCACAAGGCGGCCATCCAAGCCGACCTCAAATACCTTTACTCGGCCTTCACCAAGATTCCA
TGCCTCCGCTTGGCCCCCGATTGGCGAGCCCGAATGATCAAAGGCTACGAAGAGTTCCCTTTTGACTCGGCCGTG
CCGCTCTACGTATTCAAGAACCTGCAGGCCCTCGAAATCCGGAATCTCGACTTCCGACAGTTCTTTGGCTGGGAT
CGCCTGGCGGATCAGCTCCGATCGCTCAGCCTGAGACGGGCCGGTATCGAGGACCCCGCCGACATACTCATCGAC
ATCGTCCTGGACGACATGGACAAGAGACGCCGCAGATCGTCTAAATCTCAGGCCTCCCCGACGGCGACGCTTGTG
GCCAATAGCAGCCCTCGGCGAAGCCCCACGATACCCCATCTCGAGCTCGTACGGGCGGCGTCGGCCCCCGGGTCG
CCCGACACGCGAAGCGCCCTCGCCGACCTGCGCGTCGGCTCCATGACGCCCAGCGACCCGGCCGTCGAGGACACG
GACGCGTCCGACGCCGGCCGAACCCCCGTCGCCCGCGACGATGCCGATGGCCACCGACGGTCGCCGACTAGACGA
GCGCGCCCGAGGAGCAACTCGCCGACCCGCCCGGCCAGCTCCAGAAATTACTCGTCCAACATCCGCTCCTCGCAG
CGCATCAGGCGCTCGGGCTCCGGGAGCTCCCACTCCAGCATGTCCGACTCGTGGCATTACCACGCCAGGGGGAGC
TCGGGGAACCTCCTGGCCATGGGCGTCCTGCCCTCGACCAAGTGGCGCTTCCTGCGTCACCTGAGCCTCGCGGAC
AACGCCCTGACGTCGATCCCTCAAGCAAGCCTTGCGCCCCTCTCCAATACGCTGCGCTCGCTCGACCTATCGTCG
AACCTGTTCAGTCAAATTCCCGACAGCCTCGCGACGCTGACTGCTCTTCGCGCCCTCAACCTGTCGAACTGCATG
ATCGACTCCCTCCACTCTCTCACGCGCAGCCCGCTGCCGGCCATGACGGCGCTCAACCTGCGCGCCAACAGGCTC
CGGTCGCTCGCGGGCGTCGAGAAGCTCTGTCCGCTCGAGAGGCTGGACCTCCGGGACAATCAGCTGACGGACCCC
CGGGAGCTGGCCCGGTTGACCGGCATGCCCGACCTGCGCGAGATCTGGGTCGAGGGTAATCCGTTCACCCGCACC
CACAAGAACCATCACGTCATCATCTTCAACCTGTTCCGGTCGACGCCAGGCTACACCGTGGACTTGATCATCGAC
GGCCGCGGCCCGAGCTATTCCGAACGGCGCCAGCTGGTGGAACGGGCACCCATCCCGGACTCGGTCCCGGTGGTC
AAGCCTAAGGCTCCCGACGCTCCGGCCGTCGTCGACGTCGGCAAGGCAGTGCCGAGCGAAGCCAGCGTTGGCTCG
GCTCGTCGTCGCAACAAGGCGTCAAAGAGACGCATCGTCGACCTGGCGAGCGGCGACGTCTCGCTCCCTCCTTTG
GCCGTCGACACAGGCGCCCAGACGGCTGAAGACGCGACCAAGGTGGACGTGTCGGAGGTCTCGCCGTCGGATGGC
TATCGCACCTCGCGCCCCACCGAGTCGGTGCTGTTGCCCCCGGTGAGACTGTCGCCTAGCGGAGAGTCGGGCGGC
GCCGGGCGGCGGGCGGCGGACGTGGGGTCCGGGCTGCCGGCTGACGCGGACCCGCAAGACTGGGATGTCAGCGGC
GAAATCTACCGGCGCAGGATCCAGAACCTGCGCGACCGCGTCGGCAGCGGCTACCTGAGCGTCCTGAGCGAGGAG
AGTTGGGACGGGACAGGCAGCTTTAACGCGGCTGGCTCGACGTCGATCCCGCCACTCCGTGCTGGCCACCTTTCA
AGCAACACACTGTCTGCTCAGGCGGTTCACAGCGGCCCCACGATGGGC
Transcript >Ophio5|1598
ATGAGTTCCGAAGACGGAGACTACTTCATCAAGCGCCTGGTCACATTCGTTCGGACGCACGAGAAATCCATAGCC
AATGCGCTCCAGTTCCAGCGCCGCGAGGTCCGTCACAGGTCCTCTCAAAGCACCGGCTCGGCCACGCTGTCCCTG
TCTCCCACTCTACCGGAGCGACCCTCGACGTCTTCGGTGCCGAATTCTCTCGCTGCTGCCTTATCCTTTGGATCC
ATCAACTTCACCTCGCACAATGCCAAGTCGGTGAGGCTGGCCCTGACGCCCCACCACCTGTTCTTCCTCCTCTCC
CGCTTTGAGGAGCTCAACATCCAGGTCGGGCCCATGAAAGTGCGCCTTGAAGACCTCCACGACAGCTCATCGACC
ATCTATGTCTCCTTTCTCGGAAACACAGGCCGGTCTCGGAGTCGCAGCTCTGATGTTGGCTCCATCCATTCTGTG
TCCAGCATGCGGAGCGTCATGTCGGGCATGTCGGCTCTCTGGACGAGCTTCGGCATCGGCGCCAGCATTTCTGCG
GCCAGAACCGAGCGCCACAAGGCGGCCATCCAAGCCGACCTCAAATACCTTTACTCGGCCTTCACCAAGATTCCA
TGCCTCCGCTTGGCCCCCGATTGGCGAGCCCGAATGATCAAAGGCTACGAAGAGTTCCCTTTTGACTCGGCCGTG
CCGCTCTACGTATTCAAGAACCTGCAGGCCCTCGAAATCCGGAATCTCGACTTCCGACAGTTCTTTGGCTGGGAT
CGCCTGGCGGATCAGCTCCGATCGCTCAGCCTGAGACGGGCCGGTATCGAGGACCCCGCCGACATACTCATCGAC
ATCGTCCTGGACGACATGGACAAGAGACGCCGCAGATCGTCTAAATCTCAGGCCTCCCCGACGGCGACGCTTGTG
GCCAATAGCAGCCCTCGGCGAAGCCCCACGATACCCCATCTCGAGCTCGTACGGGCGGCGTCGGCCCCCGGGTCG
CCCGACACGCGAAGCGCCCTCGCCGACCTGCGCGTCGGCTCCATGACGCCCAGCGACCCGGCCGTCGAGGACACG
GACGCGTCCGACGCCGGCCGAACCCCCGTCGCCCGCGACGATGCCGATGGCCACCGACGGTCGCCGACTAGACGA
GCGCGCCCGAGGAGCAACTCGCCGACCCGCCCGGCCAGCTCCAGAAATTACTCGTCCAACATCCGCTCCTCGCAG
CGCATCAGGCGCTCGGGCTCCGGGAGCTCCCACTCCAGCATGTCCGACTCGTGGCATTACCACGCCAGGGGGAGC
TCGGGGAACCTCCTGGCCATGGGCGTCCTGCCCTCGACCAAGTGGCGCTTCCTGCGTCACCTGAGCCTCGCGGAC
AACGCCCTGACGTCGATCCCTCAAGCAAGCCTTGCGCCCCTCTCCAATACGCTGCGCTCGCTCGACCTATCGTCG
AACCTGTTCAGTCAAATTCCCGACAGCCTCGCGACGCTGACTGCTCTTCGCGCCCTCAACCTGTCGAACTGCATG
ATCGACTCCCTCCACTCTCTCACGCGCAGCCCGCTGCCGGCCATGACGGCGCTCAACCTGCGCGCCAACAGGCTC
CGGTCGCTCGCGGGCGTCGAGAAGCTCTGTCCGCTCGAGAGGCTGGACCTCCGGGACAATCAGCTGACGGACCCC
CGGGAGCTGGCCCGGTTGACCGGCATGCCCGACCTGCGCGAGATCTGGGTCGAGGGTAATCCGTTCACCCGCACC
CACAAGAACCATCACGTCATCATCTTCAACCTGTTCCGGTCGACGCCAGGCTACACCGTGGACTTGATCATCGAC
GGCCGCGGCCCGAGCTATTCCGAACGGCGCCAGCTGGTGGAACGGGCACCCATCCCGGACTCGGTCCCGGTGGTC
AAGCCTAAGGCTCCCGACGCTCCGGCCGTCGTCGACGTCGGCAAGGCAGTGCCGAGCGAAGCCAGCGTTGGCTCG
GCTCGTCGTCGCAACAAGGCGTCAAAGAGACGCATCGTCGACCTGGCGAGCGGCGACGTCTCGCTCCCTCCTTTG
GCCGTCGACACAGGCGCCCAGACGGCTGAAGACGCGACCAAGGTGGACGTGTCGGAGGTCTCGCCGTCGGATGGC
TATCGCACCTCGCGCCCCACCGAGTCGGTGCTGTTGCCCCCGGTGAGACTGTCGCCTAGCGGAGAGTCGGGCGGC
GCCGGGCGGCGGGCGGCGGACGTGGGGTCCGGGCTGCCGGCTGACGCGGACCCGCAAGACTGGGATGTCAGCGGC
GAAATCTACCGGCGCAGGATCCAGAACCTGCGCGACCGCGTCGGCAGCGGCTACCTGAGCGTCCTGAGCGAGGAG
AGTTGGGACGGGACAGGCAGCTTTAACGCGGCTGGCTCGACGTCGATCCCGCCACTCCGTGCTGGCCACCTTTCA
AGCAACACACTGTCTGCTCAGGCGGTTCACAGCGGCCCCACGATGGGCTAG
Gene >Ophio5|1598
ATGAGTTCCGAAGACGGAGACTACTTCATCAAGGTTGGAGGAACCATGGCTCTCTCGCCTTCTGCCTTGACGCTG
ACTCGTCACGCGCCACAGCGCCTGGTCACATTCGTTCGGACGCACGAGAAATCCATAGCCAATGCGCTCCAGTTC
CAGCGCCGCGAGGTCCGTCACAGGTCCTCTCAAAGCACCGGCTCGGCCACGCTGTCCCTGTCTCCCACTCTACCG
GAGCGACCCTCGACGTCTTCGGTGCCGAATTCTCTCGCTGCTGCCTTATCCTTTGGATCCATCAACTTCACCTCG
CACAATGCCAAGTCGGTGAGGCTGGCCCTGACGCCCCACCACCTGTTCTTCCTCCTCTCCCGCTTTGAGGAGCTC
AACATCCAGGTCGGGCCCATGAAAGTGCGCCTTGAAGACCTCCACGACAGCTCATCGACCATCTATGTCTCCTTT
CTCGGAAACACAGGCCGGTCTCGGAGTCGCAGCTCTGATGTTGGCTCCATCCATTCTGTGTCCAGCATGCGGAGC
GTCATGTCGGGCATGTCGGCTCTCTGGACGAGCTTCGGCATCGGCGCCAGCATTTCTGCGGCCAGAACCGAGCGC
CACAAGGCGGCCATCCAAGCCGACCTCAAATACCTTTACTCGGCCTTCACCAAGATTCCATGCCTCCGCTTGGCC
CCCGATTGGCGAGCCCGAATGATCAAAGGCTACGAAGAGTTCCCTTTTGACTCGGCCGTGCCGCTCTACGTATTC
AAGAACCTGCAGGCCCTCGAAATCCGGAATCTCGACTTCCGACAGTTCTTTGGCTGGGATCGCCTGGCGGATCAG
CTCCGATCGCTCAGCCTGAGACGGGCCGGTATCGAGGACCCCGCCGACATACTCATCGACATCGTCCTGGACGAC
ATGGACAAGAGACGCCGCAGATCGTCTAAATCTCAGGCCTCCCCGACGGCGACGCTTGTGGCCAATAGCAGCCCT
CGGCGAAGCCCCACGATACCCCATCTCGAGCTCGTACGGGCGGCGTCGGCCCCCGGGTCGCCCGACACGCGAAGC
GCCCTCGCCGACCTGCGCGTCGGCTCCATGACGCCCAGCGACCCGGCCGTCGAGGACACGGACGCGTCCGACGCC
GGCCGAACCCCCGTCGCCCGCGACGATGCCGATGGCCACCGACGGTCGCCGACTAGACGAGCGCGCCCGAGGAGC
AACTCGCCGACCCGCCCGGCCAGCTCCAGAAATTACTCGTCCAACATCCGCTCCTCGCAGCGCATCAGGCGCTCG
GGCTCCGGGAGCTCCCACTCCAGCATGTCCGACTCGTGGCATTACCACGCCAGGGGGAGCTCGGGGAACCTCCTG
GCCATGGGCGTCCTGCCCTCGACCAAGTGGCGCTTCCTGCGTCACCTGAGCCTCGCGGACAACGCCCTGACGTCG
ATCCCTCAAGCAAGCCTTGCGCCCCTCTCCAATACGCTGCGCTCGCTCGACCTATCGTCGAACCTGTTCAGTCAA
ATTCCCGACAGCCTCGCGACGCTGACTGCTCTTCGCGCCCTCAACCTGTCGAACTGCATGATCGACTCCCTCCAC
TCTCTCACGCGCAGCCCGCTGCCGGCCATGACGGCGCTCAACCTGCGCGCCAACAGGCTCCGGTCGCTCGCGGGC
GTCGAGAAGCTCTGTCCGCTCGAGAGGCTGGACCTCCGGGACAATCAGCTGACGGACCCCCGGGAGCTGGCCCGG
TTGACCGGCATGCCCGACCTGCGCGAGATCTGGGTCGAGGGTAATCCGTTCACCCGCACCCACAAGAACCATCAC
GTCATCATCTTCAACCTGTTCCGGTCGACGCCAGGCTACACCGTGGACTTGATCATCGACGGCCGCGGCCCGAGC
TATTCCGAACGGCGCCAGCTGGTGGAACGGGCACCCATCCCGGACTCGGTCCCGGTGGTCAAGCCTAAGGCTCCC
GACGCTCCGGCCGTCGTCGACGTCGGCAAGGCAGTGCCGAGCGAAGCCAGCGTTGGCTCGGCTCGTCGTCGCAAC
AAGGCGTCAAAGAGACGCATCGTCGACCTGGCGAGCGGCGACGTCTCGCTCCCTCCTTTGGCCGTCGACACAGGC
GCCCAGACGGCTGAAGACGCGACCAAGGTGGACGTGTCGGAGGTCTCGCCGTCGGATGGCTATCGCACCTCGCGC
CCCACCGAGTCGGTGCTGTTGCCCCCGGTGAGACTGTCGCCTAGCGGAGAGTCGGGCGGCGCCGGGCGGCGGGCG
GCGGACGTGGGGTCCGGGCTGCCGGCTGACGCGGACCCGCAAGACTGGGATGTCAGCGGCGAAATCTACCGGCGC
AGGATCCAGAACCTGCGCGACCGCGTCGGCAGCGGCTACCTGAGCGTCCTGAGCGAGGAGAGTTGGGACGGGACA
GGCAGCTTTAACGCGGCTGGCTCGACGTCGATCCCGCCACTCCGTGCTGGCCACCTTTCAAGCAACACACTGTCT
GCTCAGGCGGTTCACAGCGGCCCCACGATGGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail