Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1593
Gene name
Locationscaffold_158:12906..15867
Strand+
Gene length (bp)2961
Transcript length (bp)2433
Coding sequence length (bp)2430
Protein length (aa) 810

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 2.7E-174 113 768

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 40 810 0.0E+00
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 23 810 0.0E+00
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 93 781 1.0E-167
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 26 810 4.0E-167
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 93 780 8.0E-163
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 40 810 0.0E+00
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 23 810 0.0E+00
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 93 781 1.0E-167
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 26 810 4.0E-167
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 93 780 8.0E-163
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 85 780 6.0E-159
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 44 783 1.0E-155
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 73 782 1.0E-153
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 83 782 4.0E-151
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 80 781 1.0E-150
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 78 783 9.0E-148
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 77 790 1.0E-144
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 21 794 8.0E-116
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 32 783 7.0E-113
[Show less]

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:0022857 transmembrane transporter activity No
GO:1904680 peptide transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0042887 amide transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 116 138 22
2 143 165 22
3 194 216 22
4 247 269 22
5 289 311 22
6 324 346 22
7 361 383 22
8 431 453 22
9 488 510 22
10 515 537 22
11 563 585 22
12 667 689 22
13 704 726 22
14 747 769 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 21.42 11.18 31.65
CcL In ants, during behavior modification 21.33 10.35 32.32
CcD In ants, recently dead 21.69 11.36 32.02

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.989219 no
SC16a CcD 0.967156 no
CcL CcD 0.959880 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1593
MASSSPSAVAEAEATGFEAGGARPSHRRSDSLNSLDFLDDDDPLARAREHAPLMNDDEDVDAYELRVWPSRPETA
ADKAADDDDDDDGDKEDEDSPYAEVRAAIRNYDEDLPCSTVRVWVIGLLLVLVGASTNTLFSLRQPSISVGALVG
QMLAWPLGHVWARFMPDWHLELLGRRWRLNPGPFNVKEHSVIGVMASVSFSVAYSTDIILAQLVFYKQDFGLVFQ
MLLTVSTQSLGYGIAGAMRKYLVYPASMIWPGVLVSVTMMNVMYENNDRPDPSVIGGSMPRYRWFGLVTVAAFVY
YFVPGFLVQCLSVFAFATWMAPQNAVVNQLFGGTTGLSLVPITFDWTQIAGWVGSPLIPPWYAIANVVIGVVVFY
VAGSSLLHYSGAWYARFLPMSDADTYDNTGKPYNTSRVLTADFTLDEEAYRAYSPLFISTSFAMAYGLAFAAISS
LIVHTLLHYRKQIWRQYRNSTGEKPDIHMKLMSRYTEAPASWYLSLFVAMLTLGLYTVLAYPTKLSWWAYLLAVS
ISYGFALPIGIIEAVTNNQIGLNVLTEFVYGYIQPGRPLALMIFKTFGYVTMSQALRFVADLKFGHYMKIPPRTM
FSAQVVATTLSCAVQIVTLNLALGSIENVCDTQQRDRFTCPGGRVFFSASVIWGLIGPDRMFSPGRIYSGLFLFF
FLGAITPIAIHVASKRYPRSPLRYLMAPLIFGGAGAIPPATPLNYFSWAMVGFVFQYWIKKRHFAWWSRLNFLTS
CGLDLGLALATLFIFFAFSMHGIKPPRWWGNTVVSTTMDVQGTAVQAQVAEGQRFGPDAW
Coding >Ophio5|1593
ATGGCCTCGTCGTCGCCCAGCGCGGTGGCCGAGGCCGAAGCCACGGGCTTTGAAGCCGGCGGCGCCAGGCCGTCA
CACCGACGATCCGACTCTCTCAATAGCCTGGATTTTCTCGACGATGATGACCCGCTCGCGAGGGCGCGCGAGCAT
GCGCCGCTGATGAATGATGACGAGGACGTTGACGCGTACGAGCTCCGAGTCTGGCCGTCGCGTCCCGAGACTGCG
GCCGATAAGGCAGCCGACGACGACGACGACGACGACGGCGACAAGGAAGACGAGGACTCGCCCTATGCCGAGGTC
AGGGCCGCTATCCGCAACTACGATGAGGACCTCCCATGCAGCACCGTTCGAGTCTGGGTCATCGGTCTGCTGCTG
GTTCTCGTCGGCGCCTCGACCAATACCCTCTTCTCGTTGCGGCAACCGTCCATCTCGGTGGGCGCGCTGGTGGGC
CAGATGCTCGCCTGGCCGCTGGGGCATGTCTGGGCGCGCTTCATGCCGGATTGGCACTTGGAGCTGCTCGGTCGA
CGCTGGAGGCTGAACCCGGGACCGTTCAATGTCAAGGAGCATAGCGTGATTGGCGTCATGGCCAGTGTTTCCTTC
TCCGTCGCCTACTCCACTGACATCATCCTGGCCCAGCTCGTCTTTTACAAGCAGGACTTTGGTCTGGTCTTTCAG
ATGCTGTTGACGGTATCGACGCAATCGCTGGGATACGGCATCGCCGGCGCCATGCGCAAGTATCTGGTCTATCCG
GCTTCGATGATCTGGCCCGGCGTTCTCGTCTCCGTCACCATGATGAACGTCATGTACGAGAATAACGACCGGCCG
GACCCCTCCGTCATCGGCGGCTCCATGCCTCGCTACCGCTGGTTCGGCCTCGTGACCGTCGCCGCCTTCGTCTAC
TACTTCGTCCCCGGCTTTCTGGTCCAGTGTCTCAGCGTCTTCGCCTTCGCCACCTGGATGGCGCCGCAGAACGCC
GTGGTGAACCAGCTCTTTGGCGGTACGACGGGCCTGTCCCTCGTGCCCATTACCTTTGACTGGACCCAGATCGCC
GGCTGGGTCGGCTCGCCTTTGATTCCGCCTTGGTACGCCATCGCCAACGTCGTCATTGGCGTTGTCGTCTTCTAC
GTCGCTGGCTCGTCTCTGCTGCATTATTCGGGCGCCTGGTATGCTCGCTTTCTGCCCATGAGCGATGCCGACACA
TATGATAATACAGGTAAGCCGTATAATACGTCGCGTGTCCTCACTGCCGACTTTACTCTCGACGAGGAGGCCTAC
CGCGCCTACTCGCCGCTGTTCATCAGCACATCCTTCGCCATGGCCTACGGCTTAGCCTTCGCCGCCATCTCCTCC
CTCATCGTTCATACCCTCCTTCACTATCGCAAGCAGATCTGGAGACAGTACCGCAACAGCACGGGCGAGAAGCCA
GACATCCACATGAAGCTCATGAGCCGCTATACCGAGGCGCCCGCCTCGTGGTATCTGTCCCTCTTCGTCGCCATG
CTCACCCTCGGACTCTACACCGTGCTGGCCTATCCCACCAAGCTGTCATGGTGGGCGTACCTGCTCGCCGTCTCC
ATCTCGTACGGCTTCGCCCTGCCCATCGGCATCATCGAGGCCGTGACGAATAACCAGATCGGTCTCAACGTCCTC
ACCGAGTTCGTCTACGGATATATCCAGCCGGGCAGGCCTCTGGCTCTCATGATCTTCAAGACGTTTGGATACGTC
ACAATGTCGCAGGCGCTGCGCTTCGTCGCCGATCTCAAGTTCGGGCACTACATGAAGATCCCCCCTCGGACCATG
TTCTCAGCCCAGGTCGTCGCCACGACGCTGTCATGCGCCGTCCAGATCGTCACTCTCAACCTCGCACTCGGCAGC
ATCGAAAATGTGTGTGACACCCAGCAGCGTGACCGCTTCACCTGTCCCGGCGGCCGAGTCTTCTTCTCCGCGTCC
GTCATCTGGGGCCTCATCGGTCCGGACCGCATGTTCTCCCCGGGTCGCATCTACTCGGGCCTCTTCCTCTTCTTC
TTCCTCGGCGCCATCACCCCCATCGCCATCCACGTCGCCTCCAAGCGCTACCCGCGCTCGCCGCTCCGCTACCTC
ATGGCACCGCTCATCTTCGGCGGCGCCGGCGCCATCCCGCCCGCCACGCCTCTCAACTATTTCTCGTGGGCCATG
GTCGGCTTCGTCTTCCAGTATTGGATCAAGAAGCGCCACTTCGCCTGGTGGAGCCGTCTCAACTTCCTCACCTCG
TGCGGCCTGGATCTCGGCCTCGCCCTCGCCACCCTCTTCATCTTCTTCGCCTTCTCCATGCATGGAATCAAGCCG
CCGCGCTGGTGGGGAAATACTGTCGTTTCAACCACCATGGACGTCCAGGGAACCGCTGTCCAGGCACAGGTTGCC
GAGGGACAGCGCTTCGGTCCCGATGCGTGG
Transcript >Ophio5|1593
ATGGCCTCGTCGTCGCCCAGCGCGGTGGCCGAGGCCGAAGCCACGGGCTTTGAAGCCGGCGGCGCCAGGCCGTCA
CACCGACGATCCGACTCTCTCAATAGCCTGGATTTTCTCGACGATGATGACCCGCTCGCGAGGGCGCGCGAGCAT
GCGCCGCTGATGAATGATGACGAGGACGTTGACGCGTACGAGCTCCGAGTCTGGCCGTCGCGTCCCGAGACTGCG
GCCGATAAGGCAGCCGACGACGACGACGACGACGACGGCGACAAGGAAGACGAGGACTCGCCCTATGCCGAGGTC
AGGGCCGCTATCCGCAACTACGATGAGGACCTCCCATGCAGCACCGTTCGAGTCTGGGTCATCGGTCTGCTGCTG
GTTCTCGTCGGCGCCTCGACCAATACCCTCTTCTCGTTGCGGCAACCGTCCATCTCGGTGGGCGCGCTGGTGGGC
CAGATGCTCGCCTGGCCGCTGGGGCATGTCTGGGCGCGCTTCATGCCGGATTGGCACTTGGAGCTGCTCGGTCGA
CGCTGGAGGCTGAACCCGGGACCGTTCAATGTCAAGGAGCATAGCGTGATTGGCGTCATGGCCAGTGTTTCCTTC
TCCGTCGCCTACTCCACTGACATCATCCTGGCCCAGCTCGTCTTTTACAAGCAGGACTTTGGTCTGGTCTTTCAG
ATGCTGTTGACGGTATCGACGCAATCGCTGGGATACGGCATCGCCGGCGCCATGCGCAAGTATCTGGTCTATCCG
GCTTCGATGATCTGGCCCGGCGTTCTCGTCTCCGTCACCATGATGAACGTCATGTACGAGAATAACGACCGGCCG
GACCCCTCCGTCATCGGCGGCTCCATGCCTCGCTACCGCTGGTTCGGCCTCGTGACCGTCGCCGCCTTCGTCTAC
TACTTCGTCCCCGGCTTTCTGGTCCAGTGTCTCAGCGTCTTCGCCTTCGCCACCTGGATGGCGCCGCAGAACGCC
GTGGTGAACCAGCTCTTTGGCGGTACGACGGGCCTGTCCCTCGTGCCCATTACCTTTGACTGGACCCAGATCGCC
GGCTGGGTCGGCTCGCCTTTGATTCCGCCTTGGTACGCCATCGCCAACGTCGTCATTGGCGTTGTCGTCTTCTAC
GTCGCTGGCTCGTCTCTGCTGCATTATTCGGGCGCCTGGTATGCTCGCTTTCTGCCCATGAGCGATGCCGACACA
TATGATAATACAGGTAAGCCGTATAATACGTCGCGTGTCCTCACTGCCGACTTTACTCTCGACGAGGAGGCCTAC
CGCGCCTACTCGCCGCTGTTCATCAGCACATCCTTCGCCATGGCCTACGGCTTAGCCTTCGCCGCCATCTCCTCC
CTCATCGTTCATACCCTCCTTCACTATCGCAAGCAGATCTGGAGACAGTACCGCAACAGCACGGGCGAGAAGCCA
GACATCCACATGAAGCTCATGAGCCGCTATACCGAGGCGCCCGCCTCGTGGTATCTGTCCCTCTTCGTCGCCATG
CTCACCCTCGGACTCTACACCGTGCTGGCCTATCCCACCAAGCTGTCATGGTGGGCGTACCTGCTCGCCGTCTCC
ATCTCGTACGGCTTCGCCCTGCCCATCGGCATCATCGAGGCCGTGACGAATAACCAGATCGGTCTCAACGTCCTC
ACCGAGTTCGTCTACGGATATATCCAGCCGGGCAGGCCTCTGGCTCTCATGATCTTCAAGACGTTTGGATACGTC
ACAATGTCGCAGGCGCTGCGCTTCGTCGCCGATCTCAAGTTCGGGCACTACATGAAGATCCCCCCTCGGACCATG
TTCTCAGCCCAGGTCGTCGCCACGACGCTGTCATGCGCCGTCCAGATCGTCACTCTCAACCTCGCACTCGGCAGC
ATCGAAAATGTGTGTGACACCCAGCAGCGTGACCGCTTCACCTGTCCCGGCGGCCGAGTCTTCTTCTCCGCGTCC
GTCATCTGGGGCCTCATCGGTCCGGACCGCATGTTCTCCCCGGGTCGCATCTACTCGGGCCTCTTCCTCTTCTTC
TTCCTCGGCGCCATCACCCCCATCGCCATCCACGTCGCCTCCAAGCGCTACCCGCGCTCGCCGCTCCGCTACCTC
ATGGCACCGCTCATCTTCGGCGGCGCCGGCGCCATCCCGCCCGCCACGCCTCTCAACTATTTCTCGTGGGCCATG
GTCGGCTTCGTCTTCCAGTATTGGATCAAGAAGCGCCACTTCGCCTGGTGGAGCCGTCTCAACTTCCTCACCTCG
TGCGGCCTGGATCTCGGCCTCGCCCTCGCCACCCTCTTCATCTTCTTCGCCTTCTCCATGCATGGAATCAAGCCG
CCGCGCTGGTGGGGAAATACTGTCGTTTCAACCACCATGGACGTCCAGGGAACCGCTGTCCAGGCACAGGTTGCC
GAGGGACAGCGCTTCGGTCCCGATGCGTGGTAG
Gene >Ophio5|1593
ATGGCCTCGTCGTCGCCCAGCGCGGTGGCCGAGGCCGAAGCCACGGGCTTTGAAGCCGGCGGCGCCAGGCCGTCA
CACCGACGATCCGACTCTCTCAATAGCCTGGATTTTCTCGACGATGATGACCCGCTCGCGAGGGCGCGCGAGCAT
GCGCCGCTGATGAATGATGACGAGGACGTTGACGCGTACGAGCTCCGAGTCTGGCCGTCGCGTCCCGAGACTGCG
GCCGATAAGGCAGCCGACGACGACGACGACGACGACGGCGACAAGGAAGACGAGGACTCGCCCTATGCCGAGGTC
AGGGCCGCTATCCGCAACTACGATGAGGACCTCCCATGCAGCACCGTTCGAGTCTGGGTCATCGGTCTGCTGCTG
GTTCTCGTCGGCGCCTCGACCAATACCCTCTTCTCGTTGCGGCAACCGTCCATCTCGGTGGGCGCGCTGGTGGGC
CAGATGCTCGCCTGGCCGCTGGGGCATGTCTGGGCGCGCTTCATGCCGGATTGGCACTTGGAGCTGCTCGGTCGA
CGCTGGAGGCTGAACCCGGGACCGTTCAATGTCAAGGAGCATAGCGTGATTGGCGTCATGGCCAGTGTTTCCTTC
TCCGTCGCCTACTCCACTGACATCATCCTGGCCCAGCTCGTCTTTTACAAGCAGGACTTTGGTCTGGTCTTTCAG
ATGCTGTTGACGGTATCGACGCAATCGCTGGGATACGGCATCGCCGGCGCCATGCGCAAGTATCTGGGTCTGTCT
GTTCCATCCGGGGGAGAGGAGAGAAAAGGACTGGGGAATGGGCTGACACTCCCCCCTCGCCCTCTTCCCCCCTCC
TCTGGTTCTCCGGCAGTCTATCCGGCTTCGATGATCTGGCCCGGCGTTCTCGTCTCCGTCACCATGATGAACGTC
ATGTACGAGAATAACGACCGGCCGGACCCCTCCGTCATCGGCGGCTCCATGCCTCGCTACCGCTGGTTCGGCCTC
GTGACCGTCGCCGCCTTCGTCTACTACTTCGTCCCCGGCTTTCTGGTCCAGTGTCTCAGCGTCTTCGCCTTCGCC
ACCTGGATGGCGCCGCAGAACGCCGTGGTGAACCAGCTCTTTGGCGGTACGACGGGCCTGTCCCTCGTGCCCATT
ACCTTTGACTGGACCCAGATCGCCGGCTGGGTCGGCTCGCCTTTGATTCCGCCTTGGTGAGACCGACCTTTCTCA
TCTCCTTTTTCCTTGTTCTTCTTGCCGGTCATGGCAGCTCACGGCCTGCTCTTGTAGGTACGCCATCGCCAACGT
CGTCATTGGCGTTGTCGTCTTCTACGTCGCTGGCTCGTCTCTGCTGCATTATTCGGGCGCCTGGTATGCTCGCTT
TCTGCCCATGAGCGATGCCGACACATATGATAATACAGGTAAGCCGTATAATACGTCGCGTGTCCTCACTGCCGA
CTTTACTCTCGACGAGGAGGCCTACCGCGCCTACTCGCCGCTGTTCATCAGGTGCGTTCAGGCTGTCTATCTATG
CCTCTCCCCCTTTCCCACTTCGTCAACCAGAGTTGACACGCCCCGTCTGCTAGCACATCCTTCGCCATGGCCTAC
GGCTTAGCCTTCGCCGCCATCTCCTCCCTCATCGTTCATACCCTCCTTCACTATCGCAAGCAGATCTGGAGACAG
TACCGCAACAGCACGGGCGAGAAGCCAGACATCCACATGAAGCTCATGAGCCGCTATACCGAGGCGCCCGCCTCG
TGGTATCTGTCCCTCTTCGTCGCCGTCCGTCGTCGCCTCGGTCCTTTTCACGCCGGAACTGCATTCAGCTGACGT
CTTGCTGCTAGATGCTCACCCTCGGACTCTACACCGTGCTGGCCTATCCCACCAAGCTGTCATGGTGGGCGTACC
TGCTCGCCGTCTCCATCTCGTACGGCTTCGCCCTGCCCATCGGCATCATCGAGGCCGTGACGAATAACCAGATCG
GTCTCAACGTCCTCACCGAGTTCGTCTACGGATATATCCAGCCGGGCAGGCCTCTGGCTCTCATGATGTACGAGG
CCCGTCTTTCTCCCTCGTTGCTCTTGCTCCGACTGACCCCCCTTCTTTCGACGGACAGCTTCAAGACGTTTGGAT
ACGTCACAATGTCCGTTGCCACGTCTTCTTTCTGTTTCCTTTCCCTCTTGGCAGTCGTGCTGACCTTGAAGTCGA
CAGGTCGCAGGCGCTGCGCTTCGTCGCCGATCTCAAGTTCGGGCACTACATGAAGATCCCCCCTCGGACCATGTT
CTCAGCCCAGGTCGTCGCCACGACGCTGTCATGCGCCGTCCAGATCGTCACTCTCAACCTCGCACTCGGCAGCAT
CGAAAATGTGTGTGACACCCAGCAGCGTGACCGCTTCACCTGTCCCGGCGGCCGAGTCTTCTTCTCCGGTGAGCC
TCCCCTCCCTTCCCCCCCCCTTTTTTTTTGGTTCCCCCTTGTCTCCTTTATCCTACCTGACCAACTCCGGAAGCG
TCCGTCATCTGGGGCCTCATCGGTCCGGACCGCATGTTCTCCCCGGGTCGCATCTACTCGGGCCTCTTCCTCTTC
TTCTTCCTCGGCGCCATCACCCCCATCGCCATCCACGTCGCCTCCAAGCGCTACCCGCGCTCGCCGCTCCGCTAC
CTCATGGCACCGCTCATCTTCGGCGGCGCCGGCGCCATCCCGCCCGCCACGCCTCTCAACTATTTCTCGTGGGCC
ATGGTCGGCTTCGTCTTCCAGTATTGGATCAAGAAGCGCCACTTCGCCTGGTGGAGCCGTCTCAACTTCCTCACC
TCGTGCGGCCTGGATCTCGGCCTCGCCCTCGCCACCCTCTTCATCTTCTTCGCCTTCTCCATGCATGGAATCAAG
CCGCCGCGCTGGTGGGGAAATACTGTCGTTTCAACCACCATGGACGTCCAGGGAACCGCTGTCCAGGCACAGGTT
GCCGAGGGACAGCGCTTCGGTCCCGATGCGTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail