Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1584
Gene name
Locationscaffold_1570:306..1045
Strand+
Gene length (bp)739
Transcript length (bp)468
Coding sequence length (bp)465
Protein length (aa) 155

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 1.1E-09 79 143

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1543 0.1446 0.9166 0.1025 0.1476 0.0247 0.1116 0.1359 0.1158 0.019

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3383
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1472
Ophiocordyceps australis 1348a (Ghana) OphauG2|984
Ophiocordyceps australis map64 (Brazil) OphauB2|4882
Ophiocordyceps australis map64 (Brazil) OphauB2|4996
Ophiocordyceps camponoti-floridani Ophcf2|03269
Ophiocordyceps kimflemingae Ophio5|1584 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6324

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1584
MWATSNEARNSCLWYGGAKLVYLDLQMLKESRTQPTIKRSRLVSNLNCLPASSCHKKVMHVKTALLAVFAVVATA
QDFSSAPLCAQTCFDNSIEASGCTKAGGLFCLCRSRKYIHDVKTCVMRTCVSNNDKRSTLAWALSQCKSVGVSIS
GSRIF
Coding >Ophio5|1584
ATGTGGGCTACAAGCAACGAGGCAAGAAACTCATGTCTGTGGTACGGTGGTGCGAAGCTTGTCTATCTCGACCTT
CAGATGCTCAAGGAGAGCCGAACACAGCCAACTATAAAGAGGTCTCGCTTAGTCTCGAACCTGAATTGTTTACCC
GCTTCTTCTTGTCATAAAAAGGTTATGCATGTCAAAACTGCTCTTCTCGCTGTCTTTGCCGTCGTCGCTACAGCG
CAGGACTTTTCCAGCGCTCCCCTATGCGCTCAGACCTGTTTTGACAACAGTATCGAGGCATCCGGCTGTACGAAA
GCAGGTGGTTTGTTTTGCTTGTGCAGATCGAGGAAGTATATACATGACGTCAAGACTTGTGTCATGCGCACGTGT
GTCTCGAACAACGATAAGAGATCAACTCTCGCCTGGGCACTCAGCCAATGCAAATCTGTAGGGGTCTCTATATCC
GGTAGTAGAATATTC
Transcript >Ophio5|1584
ATGTGGGCTACAAGCAACGAGGCAAGAAACTCATGTCTGTGGTACGGTGGTGCGAAGCTTGTCTATCTCGACCTT
CAGATGCTCAAGGAGAGCCGAACACAGCCAACTATAAAGAGGTCTCGCTTAGTCTCGAACCTGAATTGTTTACCC
GCTTCTTCTTGTCATAAAAAGGTTATGCATGTCAAAACTGCTCTTCTCGCTGTCTTTGCCGTCGTCGCTACAGCG
CAGGACTTTTCCAGCGCTCCCCTATGCGCTCAGACCTGTTTTGACAACAGTATCGAGGCATCCGGCTGTACGAAA
GCAGGTGGTTTGTTTTGCTTGTGCAGATCGAGGAAGTATATACATGACGTCAAGACTTGTGTCATGCGCACGTGT
GTCTCGAACAACGATAAGAGATCAACTCTCGCCTGGGCACTCAGCCAATGCAAATCTGTAGGGGTCTCTATATCC
GGTAGTAGAATATTCTAG
Gene >Ophio5|1584
ATGTGGGCTACAAGGCAGGTTCACGCTTGATCACGATTTTGTTTTGCAGCTGCCGCTAACCTGTGTCCACGCAAG
CAACGAGGCAAGGTAATGCGTATTGCAGGCCCACCCACAGATCTTGATGACGCTCACAGGTCAAGAAACTCATGT
CTGTGGTACGGTGGTGCGAAGCTTGTCTATCTCGACCTTCAGATGCTCAAGGAGAGCCGAACACAGCCAACTATA
AAGAGGTCTCGCTTAGTCTCGAACCTGAATTGTTTACCCGCTTCTTCTTGTCATAAAAAGATCAGTATCGTTACT
CTTCCTCATCTCTTTATCCCTGACTCACGAATATCTTCACGTTATGCATGTCAAAACTGCTCTTCTCGCTGTCTT
TGCCGTCGTCGCTACAGCGCAGGACTTTTCCAGCGCTCCCCTATGCGCTCAGACCTGTTTTGACAACAGTATCGA
GGCATCCGGCTGTACGAAAGCAGGTGGTTTGTTTTGCTTGTGCAGGTGAGTCTTCCAGTGTAGGTGTATCACAGT
TTTTAACCATCGCCCTAGATCGAGGAAGTATATACATGACGTCAAGACTTGTGTCATGCGCACGTGTGTCTCGAA
CAACGATAAGTGGGTTACATGTGCTCTGCATTTATCTATATGGACATTAACCTTATGGAATAGGAGATCAACTCT
CGCCTGGGCACTCAGCCAATGCAAATCTGTAGGGGTCTCTATATCCGGTAGTAGAATATTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail