Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1578
Gene name
Locationscaffold_157:19615..22179
Strand-
Gene length (bp)2564
Transcript length (bp)2511
Coding sequence length (bp)2508
Protein length (aa) 836

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 6.2E-31 571 790

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09844|YAE3_SCHPO TBC domain-containing protein C23D3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23D3.03c PE=3 SV=1 454 832 3.0E-55
sp|Q0IHY4|TBC12_XENTR TBC1 domain family member 12 OS=Xenopus tropicalis GN=tbc1d12 PE=2 SV=1 465 808 9.0E-55
sp|Q9P2M4|TBC14_HUMAN TBC1 domain family member 14 OS=Homo sapiens GN=TBC1D14 PE=1 SV=3 450 790 5.0E-53
sp|O60347|TBC12_HUMAN TBC1 domain family member 12 OS=Homo sapiens GN=TBC1D12 PE=1 SV=3 465 808 6.0E-53
sp|A6H7I8|TBC14_BOVIN TBC1 domain family member 14 OS=Bos taurus GN=TBC1D14 PE=2 SV=2 445 786 8.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09844|YAE3_SCHPO TBC domain-containing protein C23D3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23D3.03c PE=3 SV=1 454 832 3.0E-55
sp|Q0IHY4|TBC12_XENTR TBC1 domain family member 12 OS=Xenopus tropicalis GN=tbc1d12 PE=2 SV=1 465 808 9.0E-55
sp|Q9P2M4|TBC14_HUMAN TBC1 domain family member 14 OS=Homo sapiens GN=TBC1D14 PE=1 SV=3 450 790 5.0E-53
sp|O60347|TBC12_HUMAN TBC1 domain family member 12 OS=Homo sapiens GN=TBC1D12 PE=1 SV=3 465 808 6.0E-53
sp|A6H7I8|TBC14_BOVIN TBC1 domain family member 14 OS=Bos taurus GN=TBC1D14 PE=2 SV=2 445 786 8.0E-53
sp|Q5CD77|TBC14_RAT TBC1 domain family member 14 OS=Rattus norvegicus GN=Tbc1d14 PE=2 SV=2 466 790 1.0E-51
sp|Q8CGA2|TBC14_MOUSE TBC1 domain family member 14 OS=Mus musculus GN=Tbc1d14 PE=1 SV=2 466 790 2.0E-51
sp|Q6A039|TBC12_MOUSE TBC1 domain family member 12 OS=Mus musculus GN=Tbc1d12 PE=1 SV=2 465 808 7.0E-51
sp|O96904|TBC12_DICDI Drainin OS=Dictyostelium discoideum GN=phgA PE=1 SV=1 485 814 9.0E-38
sp|Q9BXI6|TB10A_HUMAN TBC1 domain family member 10A OS=Homo sapiens GN=TBC1D10A PE=1 SV=1 546 792 6.0E-20
sp|P58802|TB10A_MOUSE TBC1 domain family member 10A OS=Mus musculus GN=Tbc1d10a PE=1 SV=1 546 792 8.0E-20
sp|Q8BHL3|TB10B_MOUSE TBC1 domain family member 10B OS=Mus musculus GN=Tbc1d10b PE=1 SV=2 622 792 6.0E-17
sp|Q4KMP7|TB10B_HUMAN TBC1 domain family member 10B OS=Homo sapiens GN=TBC1D10B PE=1 SV=3 622 792 3.0E-16
sp|Q8C9V1|TB10C_MOUSE Carabin OS=Mus musculus GN=Tbc1d10c PE=1 SV=1 620 799 1.0E-14
sp|Q8IV04|TB10C_HUMAN Carabin OS=Homo sapiens GN=TBC1D10C PE=1 SV=1 620 786 1.0E-14
sp|Q09830|YAD4_SCHPO TBC domain-containing protein C4G8.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.04 PE=1 SV=1 556 832 3.0E-14
sp|B5DFA1|TBD2A_RAT TBC1 domain family member 2A OS=Rattus norvegicus GN=Tbc1d2 PE=2 SV=1 653 806 5.0E-14
sp|B1AVH7|TBD2A_MOUSE TBC1 domain family member 2A OS=Mus musculus GN=Tbc1d2 PE=2 SV=1 653 806 6.0E-14
sp|Q9VYY9|EVI5_DROME Ecotropic viral integration site 5 ortholog OS=Drosophila melanogaster GN=Evi5 PE=1 SV=3 625 787 3.0E-13
sp|Q80XC3|US6NL_MOUSE USP6 N-terminal-like protein OS=Mus musculus GN=Usp6nl PE=1 SV=2 547 794 1.0E-12
sp|Q9BYX2|TBD2A_HUMAN TBC1 domain family member 2A OS=Homo sapiens GN=TBC1D2 PE=1 SV=3 653 818 4.0E-12
sp|Q92738|US6NL_HUMAN USP6 N-terminal-like protein OS=Homo sapiens GN=USP6NL PE=1 SV=3 547 794 6.0E-12
sp|Q6GLZ0|GRTP1_XENLA Growth hormone-regulated TBC protein 1 OS=Xenopus laevis GN=grtp1 PE=2 SV=1 646 797 1.0E-11
sp|Q6PBU5|GRT1A_DANRE Growth hormone-regulated TBC protein 1-A OS=Danio rerio GN=grtp1a PE=2 SV=1 646 793 2.0E-11
sp|Q6GL87|GRTP1_XENTR Growth hormone-regulated TBC protein 1 OS=Xenopus tropicalis GN=grtp1 PE=2 SV=1 639 797 4.0E-10
sp|A6H8I2|SGSM3_XENLA Small G protein signaling modulator 3 homolog OS=Xenopus laevis GN=sgsm3 PE=2 SV=1 653 802 5.0E-10
sp|A6QP29|TBD2A_BOVIN TBC1 domain family member 2A OS=Bos taurus GN=TBC1D2 PE=2 SV=1 653 806 6.0E-10
sp|Q4QQU7|GRTP1_RAT Growth hormone-regulated TBC protein 1 OS=Rattus norvegicus GN=Grtp1 PE=2 SV=1 646 802 7.0E-10
sp|Q6P6R7|SGSM3_RAT Small G protein signaling modulator 3 OS=Rattus norvegicus GN=Sgsm3 PE=1 SV=1 653 802 1.0E-09
sp|Q8VCZ6|SGSM3_MOUSE Small G protein signaling modulator 3 OS=Mus musculus GN=Sgsm3 PE=1 SV=1 653 802 1.0E-09
sp|Q96HU1|SGSM3_HUMAN Small G protein signaling modulator 3 OS=Homo sapiens GN=SGSM3 PE=1 SV=1 653 802 2.0E-09
sp|Q2KI13|SGSM3_BOVIN Small G protein signaling modulator 3 OS=Bos taurus GN=SGSM3 PE=2 SV=1 653 802 2.0E-09
sp|Q5RCW6|RBG1L_PONAB Rab GTPase-activating protein 1-like OS=Pongo abelii GN=RABGAP1L PE=2 SV=1 643 786 2.0E-09
sp|A0A087WXS9|TBC3I_HUMAN TBC1 domain family member 3I OS=Homo sapiens GN=TBC1D3I PE=3 SV=1 437 779 3.0E-09
sp|Q5R372|RBG1L_HUMAN Rab GTPase-activating protein 1-like OS=Homo sapiens GN=RABGAP1L PE=1 SV=1 643 786 3.0E-09
sp|Q12317|MSB4_YEAST GTPase-activating protein MSB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB4 PE=1 SV=1 640 813 3.0E-09
sp|B9A6J9|TBC3L_HUMAN TBC1 domain family member 3L OS=Homo sapiens GN=TBC1D3L PE=2 SV=1 437 779 3.0E-09
sp|A0A087WVF3|TBC3D_HUMAN TBC1 domain family member 3D OS=Homo sapiens GN=TBC1D3D PE=2 SV=1 437 779 3.0E-09
sp|Q6IPX1|TBC3C_HUMAN TBC1 domain family member 3C OS=Homo sapiens GN=TBC1D3C PE=2 SV=3 437 779 3.0E-09
sp|Q8IZP1|TBC3A_HUMAN TBC1 domain family member 3 OS=Homo sapiens GN=TBC1D3 PE=1 SV=6 437 779 3.0E-09
sp|Q755I4|GYP5_ASHGO GTPase-activating protein GYP5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GYP5 PE=3 SV=2 649 797 4.0E-09
sp|A0A087X179|TBC3E_HUMAN TBC1 domain family member 3E OS=Homo sapiens GN=TBC1D3E PE=2 SV=1 437 779 4.0E-09
sp|P0C7X1|TBC3H_HUMAN TBC1 domain family member 3H OS=Homo sapiens GN=TBC1D3H PE=2 SV=3 437 779 4.0E-09
sp|Q96CN4|EVI5L_HUMAN EVI5-like protein OS=Homo sapiens GN=EVI5L PE=1 SV=1 625 786 5.0E-09
sp|O60343|TBCD4_HUMAN TBC1 domain family member 4 OS=Homo sapiens GN=TBC1D4 PE=1 SV=2 644 802 5.0E-09
sp|A6NER0|TBC3F_HUMAN TBC1 domain family member 3F OS=Homo sapiens GN=TBC1D3F PE=2 SV=3 437 779 7.0E-09
sp|Q5TC63|GRTP1_HUMAN Growth hormone-regulated TBC protein 1 OS=Homo sapiens GN=GRTP1 PE=1 SV=4 646 802 7.0E-09
sp|Q6DHY5|TBC3G_HUMAN TBC1 domain family member 3G OS=Homo sapiens GN=TBC1D3G PE=2 SV=2 437 779 8.0E-09
sp|Q9Y2I9|TBC30_HUMAN TBC1 domain family member 30 OS=Homo sapiens GN=TBC1D30 PE=1 SV=2 649 808 1.0E-08
sp|A0A087X1G2|TBC3K_HUMAN TBC1 domain family member 3K OS=Homo sapiens GN=TBC1D3K PE=3 SV=1 437 779 1.0E-08
sp|Q7T2D0|SGSM3_DANRE Small G protein signaling modulator 3 OS=Danio rerio GN=sgsm3 PE=2 SV=1 653 802 2.0E-08
sp|C8VDQ4|GYP2_EMENI Putative GTPase-activating protein AN11010 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN11010 PE=3 SV=1 653 786 3.0E-08
sp|A6NDS4|TBC3B_HUMAN TBC1 domain family member 3B OS=Homo sapiens GN=TBC1D3B PE=2 SV=2 437 779 3.0E-08
sp|D2H0G5|TBD2A_AILME TBC1 domain family member 2A OS=Ailuropoda melanoleuca GN=TBC1D2 PE=3 SV=1 653 774 9.0E-08
sp|Q12344|GYP5_YEAST GTPase-activating protein GYP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP5 PE=1 SV=1 648 794 4.0E-07
sp|Q6FKH3|SBE22_CANGA Protein SBE22 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SBE22 PE=3 SV=1 470 610 7.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1578
MAAAGVVPRFGARPALLPGQVVQVGWQVPLVFPASILPGRSDIANSAHHQFLTILYIPLPTNISVGFHRSFTVDF
VASRFLSRLAVSRRPCHPSDPVLDRPRRSVDLDPVGQRRRDRAARPCPVCHAAAMIREQVITLPSRDSPPGMTTS
KSSKSSSFHSLNSHDGSLLGDVGHFEDIGLDDDGATLKSPSCLPVPTPNAPPTPLPHTRNLASAKRSPTPRRSFP
NLHANLHSSNPRSTNLAVLTDPRSLALPRGPSPVSLIRRNRSTSPVLSPNHRDHGRPRTPRRGSWQANRDRKTFT
ELENECDDDDGDDIPDHIVLDNVPISPRPVNERPPSRSPTVSPPLDRALKDRVRSVGNGTPPVAQDHGSLRSPSW
RSDSSDRSPMSASKLRTTNWNAALAELSAEAKALTEKLEEHADGQEEHYVRQPPNSGRPNTWNPSHTHTAHMYDK
KERVKSSTPELPPLRRTNIMIDPLPISKEKEAVLSRTRPSWLPPKDPSEEKRHLREYQEMMAASAKADERREAAR
RSKTETRDTNADNVMHIWEDDILPRWNQAIRERRTREMWWRGIAPRSRGRVWTRAIANELGLTTATFRTALSRVR
DVETRMSMERGDAEDARRAQWFERIRRDAGEDTWTELRIFQPGGPLNRALVDVLSAYAMYRNDIGYVPGSNAIAA
LLLLNLPDAEAAFIALANLLNRPLPLSFYTSDEGAQASAFNLVLQTLSKRSPVLHDHLTHTVADLQPELYLGHLF
TSLFADYLSIDEAARLWDVYVFEGDALLVRAAVAVLLRHEMAMLGSKTAHEIRAVMTKPNGRSVHPVAPVGAEDC
FMRLVREAGKA
Coding >Ophio5|1578
ATGGCAGCAGCGGGTGTGGTGCCCAGATTTGGCGCGCGCCCCGCCCTCCTTCCTGGCCAAGTGGTACAGGTAGGT
TGGCAGGTACCACTCGTATTTCCAGCTTCCATTTTGCCCGGGAGATCGGACATCGCCAACTCGGCTCATCATCAA
TTCTTAACAATTCTGTACATACCACTACCAACAAATATCTCTGTCGGCTTCCATCGCTCTTTCACCGTCGATTTC
GTTGCGTCTCGCTTCCTCTCTCGCCTGGCCGTCTCTCGCCGCCCATGTCATCCCTCTGACCCTGTTCTTGACCGG
CCCCGTCGATCCGTCGACCTCGACCCCGTCGGACAGCGACGACGAGATCGTGCCGCTCGGCCTTGTCCCGTCTGC
CATGCCGCCGCTATGATCCGCGAACAGGTCATCACCTTGCCATCGCGCGACTCTCCGCCGGGCATGACCACCTCC
AAGAGCTCCAAGTCATCCTCTTTTCACTCCCTCAACAGCCACGACGGCAGCCTTCTGGGCGATGTCGGCCATTTT
GAGGACATTGGGCTCGACGACGATGGTGCCACCCTCAAAAGCCCTTCCTGCCTGCCTGTCCCGACGCCCAATGCC
CCGCCGACGCCGCTCCCTCATACGCGCAACCTCGCGTCGGCAAAGCGCTCCCCGACGCCTCGACGCTCCTTTCCC
AACCTTCACGCCAATCTCCACTCATCGAACCCGAGAAGCACAAACCTAGCCGTCCTCACCGACCCGAGGTCTCTC
GCTCTGCCTAGGGGGCCGTCTCCCGTGTCGTTGATCCGCCGCAATCGAAGCACCAGTCCCGTACTGTCGCCCAAT
CATCGGGACCATGGTCGCCCTCGCACGCCTCGACGTGGCAGCTGGCAGGCCAATCGCGACCGCAAGACGTTTACC
GAGCTCGAAAACGAGTGTGACGACGACGACGGTGACGATATACCCGACCACATTGTACTCGACAACGTGCCGATC
TCGCCGCGTCCAGTCAACGAGCGTCCTCCCAGTCGTTCCCCGACGGTCTCCCCGCCGCTCGACCGCGCCCTCAAG
GATCGCGTGCGGAGCGTGGGCAATGGCACACCGCCCGTCGCTCAAGACCATGGGTCGCTTCGTTCTCCTTCGTGG
CGATCCGACTCGTCCGACCGCTCCCCGATGAGCGCATCCAAATTGAGGACCACCAACTGGAACGCCGCACTGGCC
GAACTGAGCGCCGAGGCCAAGGCTCTGACAGAAAAGCTCGAGGAGCACGCCGACGGGCAGGAGGAGCACTATGTC
AGGCAGCCTCCGAATTCTGGCAGGCCAAACACGTGGAACCCGAGTCATACGCACACGGCGCACATGTACGACAAG
AAAGAGAGGGTCAAGTCGTCAACGCCCGAACTGCCCCCACTTAGGAGGACCAACATTATGATCGATCCGCTACCC
ATCTCCAAGGAGAAGGAGGCGGTCCTGAGTCGCACCCGGCCGTCGTGGCTGCCGCCCAAGGATCCCAGCGAGGAG
AAACGGCATCTGCGCGAATATCAGGAGATGATGGCGGCCAGCGCCAAGGCCGACGAGCGGCGCGAAGCCGCGCGC
AGGTCGAAGACGGAGACGAGGGACACGAACGCCGATAATGTGATGCACATATGGGAAGATGACATTCTTCCTCGG
TGGAACCAGGCCATCCGCGAGCGCAGGACGCGCGAAATGTGGTGGAGAGGCATCGCTCCACGCAGCCGGGGCCGC
GTCTGGACTCGAGCCATTGCCAACGAGCTGGGTCTGACGACGGCCACCTTTCGAACCGCCTTGTCTCGGGTGCGC
GACGTAGAGACGCGGATGAGCATGGAAAGAGGGGATGCCGAGGACGCGAGGAGGGCCCAATGGTTCGAGCGCATC
CGCAGGGACGCTGGCGAGGACACCTGGACAGAGCTGCGCATCTTCCAGCCGGGTGGACCTCTGAACCGGGCTCTC
GTGGATGTACTGAGCGCCTACGCCATGTACAGGAACGACATTGGCTACGTGCCTGGTAGCAATGCTATTGCTGCG
CTGCTTCTCCTCAACTTGCCCGATGCCGAGGCGGCCTTCATCGCGCTCGCTAACTTGCTTAACCGGCCGCTGCCC
CTGTCGTTCTACACATCGGATGAAGGCGCTCAGGCGTCAGCCTTTAACCTGGTGCTGCAGACGCTGAGCAAAAGG
TCGCCCGTTTTGCATGACCACTTGACGCATACGGTGGCAGACTTGCAGCCGGAGCTGTACCTCGGCCATCTGTTT
ACAAGCCTCTTCGCCGACTATCTGTCTATCGACGAGGCGGCCAGACTGTGGGATGTGTACGTGTTTGAGGGCGAC
GCTCTACTTGTCCGCGCAGCAGTTGCGGTCCTATTGAGGCACGAGATGGCCATGCTGGGAAGCAAGACGGCCCAC
GAGATTCGGGCGGTCATGACCAAACCGAACGGCCGATCTGTGCACCCGGTGGCGCCGGTTGGGGCCGAGGATTGC
TTCATGCGGTTGGTTCGCGAGGCCGGCAAGGCC
Transcript >Ophio5|1578
ATGGCAGCAGCGGGTGTGGTGCCCAGATTTGGCGCGCGCCCCGCCCTCCTTCCTGGCCAAGTGGTACAGGTAGGT
TGGCAGGTACCACTCGTATTTCCAGCTTCCATTTTGCCCGGGAGATCGGACATCGCCAACTCGGCTCATCATCAA
TTCTTAACAATTCTGTACATACCACTACCAACAAATATCTCTGTCGGCTTCCATCGCTCTTTCACCGTCGATTTC
GTTGCGTCTCGCTTCCTCTCTCGCCTGGCCGTCTCTCGCCGCCCATGTCATCCCTCTGACCCTGTTCTTGACCGG
CCCCGTCGATCCGTCGACCTCGACCCCGTCGGACAGCGACGACGAGATCGTGCCGCTCGGCCTTGTCCCGTCTGC
CATGCCGCCGCTATGATCCGCGAACAGGTCATCACCTTGCCATCGCGCGACTCTCCGCCGGGCATGACCACCTCC
AAGAGCTCCAAGTCATCCTCTTTTCACTCCCTCAACAGCCACGACGGCAGCCTTCTGGGCGATGTCGGCCATTTT
GAGGACATTGGGCTCGACGACGATGGTGCCACCCTCAAAAGCCCTTCCTGCCTGCCTGTCCCGACGCCCAATGCC
CCGCCGACGCCGCTCCCTCATACGCGCAACCTCGCGTCGGCAAAGCGCTCCCCGACGCCTCGACGCTCCTTTCCC
AACCTTCACGCCAATCTCCACTCATCGAACCCGAGAAGCACAAACCTAGCCGTCCTCACCGACCCGAGGTCTCTC
GCTCTGCCTAGGGGGCCGTCTCCCGTGTCGTTGATCCGCCGCAATCGAAGCACCAGTCCCGTACTGTCGCCCAAT
CATCGGGACCATGGTCGCCCTCGCACGCCTCGACGTGGCAGCTGGCAGGCCAATCGCGACCGCAAGACGTTTACC
GAGCTCGAAAACGAGTGTGACGACGACGACGGTGACGATATACCCGACCACATTGTACTCGACAACGTGCCGATC
TCGCCGCGTCCAGTCAACGAGCGTCCTCCCAGTCGTTCCCCGACGGTCTCCCCGCCGCTCGACCGCGCCCTCAAG
GATCGCGTGCGGAGCGTGGGCAATGGCACACCGCCCGTCGCTCAAGACCATGGGTCGCTTCGTTCTCCTTCGTGG
CGATCCGACTCGTCCGACCGCTCCCCGATGAGCGCATCCAAATTGAGGACCACCAACTGGAACGCCGCACTGGCC
GAACTGAGCGCCGAGGCCAAGGCTCTGACAGAAAAGCTCGAGGAGCACGCCGACGGGCAGGAGGAGCACTATGTC
AGGCAGCCTCCGAATTCTGGCAGGCCAAACACGTGGAACCCGAGTCATACGCACACGGCGCACATGTACGACAAG
AAAGAGAGGGTCAAGTCGTCAACGCCCGAACTGCCCCCACTTAGGAGGACCAACATTATGATCGATCCGCTACCC
ATCTCCAAGGAGAAGGAGGCGGTCCTGAGTCGCACCCGGCCGTCGTGGCTGCCGCCCAAGGATCCCAGCGAGGAG
AAACGGCATCTGCGCGAATATCAGGAGATGATGGCGGCCAGCGCCAAGGCCGACGAGCGGCGCGAAGCCGCGCGC
AGGTCGAAGACGGAGACGAGGGACACGAACGCCGATAATGTGATGCACATATGGGAAGATGACATTCTTCCTCGG
TGGAACCAGGCCATCCGCGAGCGCAGGACGCGCGAAATGTGGTGGAGAGGCATCGCTCCACGCAGCCGGGGCCGC
GTCTGGACTCGAGCCATTGCCAACGAGCTGGGTCTGACGACGGCCACCTTTCGAACCGCCTTGTCTCGGGTGCGC
GACGTAGAGACGCGGATGAGCATGGAAAGAGGGGATGCCGAGGACGCGAGGAGGGCCCAATGGTTCGAGCGCATC
CGCAGGGACGCTGGCGAGGACACCTGGACAGAGCTGCGCATCTTCCAGCCGGGTGGACCTCTGAACCGGGCTCTC
GTGGATGTACTGAGCGCCTACGCCATGTACAGGAACGACATTGGCTACGTGCCTGGTAGCAATGCTATTGCTGCG
CTGCTTCTCCTCAACTTGCCCGATGCCGAGGCGGCCTTCATCGCGCTCGCTAACTTGCTTAACCGGCCGCTGCCC
CTGTCGTTCTACACATCGGATGAAGGCGCTCAGGCGTCAGCCTTTAACCTGGTGCTGCAGACGCTGAGCAAAAGG
TCGCCCGTTTTGCATGACCACTTGACGCATACGGTGGCAGACTTGCAGCCGGAGCTGTACCTCGGCCATCTGTTT
ACAAGCCTCTTCGCCGACTATCTGTCTATCGACGAGGCGGCCAGACTGTGGGATGTGTACGTGTTTGAGGGCGAC
GCTCTACTTGTCCGCGCAGCAGTTGCGGTCCTATTGAGGCACGAGATGGCCATGCTGGGAAGCAAGACGGCCCAC
GAGATTCGGGCGGTCATGACCAAACCGAACGGCCGATCTGTGCACCCGGTGGCGCCGGTTGGGGCCGAGGATTGC
TTCATGCGGTTGGTTCGCGAGGCCGGCAAGGCCTGA
Gene >Ophio5|1578
ATGGCAGCAGCGGGTGTGGTGCCCAGATTTGGCGCGCGCCCCGCCCTCCTTCCTGGCCAAGTGGTACAGGTAGGT
TGGCAGGTACCACTCGTATTTCCAGCTTCCATTTTGCCCGGGAGATCGGACATCGCCAACTCGGCTCATCATCAA
TTCTTAACAATTCTGTACATACCACTACCAACAAATATCTCTGTCGGCTTCCATCGCTCTTTCACCGTCGATTTC
GTTGCGTCTCGCTTCCTCTCTCGCCTGGCCGTCTCTCGCCGCCCATGTCATCCCTCTGACCCTGTTCTTGACCGG
CCCCGTCGATCCGTCGACCTCGACCCCGTCGGACAGCGACGACGAGATCGTGCCGCTCGGCCTTGTCCCGTCTGC
CATGCCGCCGCTATGATCCGCGAACAGGTCATCACCTTGCCATCGCGCGACTCTCCGCCGGGCATGACCACCTCC
AAGAGCTCCAAGTCATCCTCTTTTCACTCCCTCAACAGCCACGACGGCAGCCTTCTGGGCGATGTCGGCCATTTT
GAGGACATTGGGCTCGACGACGATGGTGCCACCCTCAAAAGCCCTTCCTGCCTGCCTGTCCCGACGCCCAATGCC
CCGCCGACGCCGCTCCCTCATACGCGCAACCTCGCGTCGGCAAAGCGCTCCCCGACGCCTCGACGCTCCTTTCCC
AACCTTCACGCCAATCTCCACTCATCGAACCCGAGAAGCACAAACCTAGCCGTCCTCACCGACCCGAGGTCTCTC
GCTCTGCCTAGGGGGCCGTCTCCCGTGTCGTTGATCCGCCGCAATCGAAGCACCAGTCCCGTACTGTCGCCCAAT
CATCGGGACCATGGTCGCCCTCGCACGCCTCGACGTGGCAGCTGGCAGGCCAATCGCGACCGCAAGACGTTTACC
GAGCTCGAAAACGAGTGTGACGACGACGACGGTGACGATATACCCGACCACATTGTACTCGACAACGTGCCGATC
TCGCCGCGTCCAGTCAACGAGCGTCCTCCCAGTCGTTCCCCGACGGTCTCCCCGCCGCTCGACCGCGCCCTCAAG
GATCGCGTGCGGAGCGTGGGCAATGGCACACCGCCCGTCGCTCAAGACCATGGGTCGCTTCGTTCTCCTTCGTGG
CGATCCGACTCGTCCGACCGCTCCCCGATGAGCGCATCCAAATTGAGGACCACCAACTGGAACGCCGCACTGGCC
GAACTGAGCGCCGAGGCCAAGGCTCTGACAGAAAAGCTCGAGGAGCACGCCGACGGGCAGGAGGAGCACTATGTC
AGGCAGCCTCCGAATTCTGGCAGGCCAAACACGTGGAACCCGAGTCATACGCACACGGCGCACATGTACGACAAG
AAAGAGAGGGTCAAGTCGTCAACGCCCGAACTGCCCCCACTTAGGAGGACCAACATTATGATCGATCCGCTACCC
ATCTCCAAGGAGAAGGAGGCGGTCCTGAGTCGCACCCGGCCGTCGTGGCTGCCGCCCAAGGATCCCAGCGAGGAG
AAACGGCATCTGCGCGAATATCAGGAGATGATGGCGGCCAGCGCCAAGGCCGACGAGCGGCGCGAAGCCGCGCGC
AGGTCGAAGACGGAGACGAGGGACACGAACGCCGATAATGTGATGCACATATGGGAAGATGACATTCTTCCTCGG
TGGAACCAGGCCATCCGCGAGCGCAGGACGCGCGAAATGTGGTGGAGAGGCATCGCTCCACGCAGCCGGGGCCGC
GTCTGGACTCGAGCCATTGCCAACGAGCTGGGTCTGACGACGGCCACCTTTCGAACCGCCTTGTCTCGGGTGCGC
GACGTAGAGACGCGGATGAGCATGGAAAGAGGGGATGCCGAGGACGCGAGGAGGGCCCAATGGTTCGAGCGCATC
CGCAGGGACGCTGGCGAGGACACCTGGACAGAGCTGCGCATCTTCCAGCCGGGTGGACCTCTGAACCGGGCTCTC
GTGGATGTACTGAGCGCCTACGCCATGTACAGGAACGACATTGGCTACGTGCCTGGTAGCAATGTGAGTCGGGTG
AACCCACGTCGGAACATGAGTGCTGACATGTTTCCCTCCAGGCTATTGCTGCGCTGCTTCTCCTCAACTTGCCCG
ATGCCGAGGCGGCCTTCATCGCGCTCGCTAACTTGCTTAACCGGCCGCTGCCCCTGTCGTTCTACACATCGGATG
AAGGCGCTCAGGCGTCAGCCTTTAACCTGGTGCTGCAGACGCTGAGCAAAAGGTCGCCCGTTTTGCATGACCACT
TGACGCATACGGTGGCAGACTTGCAGCCGGAGCTGTACCTCGGCCATCTGTTTACAAGCCTCTTCGCCGACTATC
TGTCTATCGACGAGGCGGCCAGACTGTGGGATGTGTACGTGTTTGAGGGCGACGCTCTACTTGTCCGCGCAGCAG
TTGCGGTCCTATTGAGGCACGAGATGGCCATGCTGGGAAGCAAGACGGCCCACGAGATTCGGGCGGTCATGACCA
AACCGAACGGCCGATCTGTGCACCCGGTGGCGCCGGTTGGGGCCGAGGATTGCTTCATGCGGTTGGTTCGCGAGG
CCGGCAAGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail