Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1576
Gene name
Locationscaffold_157:11333..14597
Strand-
Gene length (bp)3264
Transcript length (bp)3264
Coding sequence length (bp)3261
Protein length (aa) 1087

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 1.5E-42 867 1073
PF00122 E1-E2_ATPase E1-E2 ATPase 7.5E-39 232 428
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.1E-09 446 700
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 4.4E-09 749 798
PF13246 Cation_ATPase Cation transport ATPase (P-type) 5.3E-17 499 584
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 4.3E-10 115 181

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q64392|AT12A_CAVPO Potassium-transporting ATPase alpha chain 2 OS=Cavia porcellus GN=ATP12A PE=2 SV=1 83 1078 2.0E-172
sp|P24797|AT1A2_CHICK Sodium/potassium-transporting ATPase subunit alpha-2 OS=Gallus gallus GN=ATP1A2 PE=2 SV=1 91 1080 8.0E-171
sp|P35317|AT1A_HYDVU Sodium/potassium-transporting ATPase subunit alpha OS=Hydra vulgaris PE=2 SV=1 92 1080 2.0E-169
sp|Q6RWA9|AT1A_TAESO Sodium/potassium-transporting ATPase subunit alpha OS=Taenia solium PE=2 SV=1 116 1080 7.0E-168
sp|P06687|AT1A3_RAT Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus GN=Atp1a3 PE=1 SV=2 113 1080 2.0E-167
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q64392|AT12A_CAVPO Potassium-transporting ATPase alpha chain 2 OS=Cavia porcellus GN=ATP12A PE=2 SV=1 83 1078 2.0E-172
sp|P24797|AT1A2_CHICK Sodium/potassium-transporting ATPase subunit alpha-2 OS=Gallus gallus GN=ATP1A2 PE=2 SV=1 91 1080 8.0E-171
sp|P35317|AT1A_HYDVU Sodium/potassium-transporting ATPase subunit alpha OS=Hydra vulgaris PE=2 SV=1 92 1080 2.0E-169
sp|Q6RWA9|AT1A_TAESO Sodium/potassium-transporting ATPase subunit alpha OS=Taenia solium PE=2 SV=1 116 1080 7.0E-168
sp|P06687|AT1A3_RAT Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus GN=Atp1a3 PE=1 SV=2 113 1080 2.0E-167
sp|Q6PIC6|AT1A3_MOUSE Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus GN=Atp1a3 PE=1 SV=1 113 1080 2.0E-167
sp|P13637|AT1A3_HUMAN Sodium/potassium-transporting ATPase subunit alpha-3 OS=Homo sapiens GN=ATP1A3 PE=1 SV=3 113 1080 4.0E-167
sp|P17326|AT1A_ARTSF Sodium/potassium-transporting ATPase subunit alpha-A OS=Artemia franciscana PE=2 SV=1 113 1082 7.0E-167
sp|P24798|AT1A3_CHICK Sodium/potassium-transporting ATPase subunit alpha-3 OS=Gallus gallus GN=ATP1A3 PE=2 SV=1 113 1080 9.0E-167
sp|P05023|AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens GN=ATP1A1 PE=1 SV=1 116 1080 2.0E-166
sp|P18907|AT1A1_HORSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Equus caballus GN=ATP1A1 PE=3 SV=1 90 1080 3.0E-166
sp|Q08DA1|AT1A1_BOVIN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Bos taurus GN=ATP1A1 PE=2 SV=1 116 1080 5.0E-166
sp|P04074|AT1A1_SHEEP Sodium/potassium-transporting ATPase subunit alpha-1 OS=Ovis aries GN=ATP1A1 PE=1 SV=1 116 1080 7.0E-166
sp|P06685|AT1A1_RAT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus GN=Atp1a1 PE=1 SV=1 116 1080 7.0E-166
sp|Q8VDN2|AT1A1_MOUSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus GN=Atp1a1 PE=1 SV=1 116 1080 9.0E-166
sp|Q5RDR3|AT1A1_PONAB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Pongo abelii GN=ATP1A1 PE=2 SV=1 116 1080 1.0E-165
sp|P06686|AT1A2_RAT Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus GN=Atp1a2 PE=1 SV=1 116 1080 1.0E-165
sp|Q6PIE5|AT1A2_MOUSE Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus GN=Atp1a2 PE=1 SV=1 116 1080 1.0E-165
sp|P50993|AT1A2_HUMAN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Homo sapiens GN=ATP1A2 PE=1 SV=1 116 1080 3.0E-165
sp|P19156|ATP4A_PIG Potassium-transporting ATPase alpha chain 1 OS=Sus scrofa GN=ATP4A PE=1 SV=3 116 1078 4.0E-165
sp|P50996|ATP4A_CANLF Potassium-transporting ATPase alpha chain 1 OS=Canis lupus familiaris GN=ATP4A PE=2 SV=3 116 1078 4.0E-165
sp|Q5RCD8|AT1A2_PONAB Sodium/potassium-transporting ATPase subunit alpha-2 OS=Pongo abelii GN=ATP1A2 PE=2 SV=1 116 1080 5.0E-165
sp|P05024|AT1A1_PIG Sodium/potassium-transporting ATPase subunit alpha-1 OS=Sus scrofa GN=ATP1A1 PE=1 SV=1 116 1080 6.0E-165
sp|P13607|ATNA_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster GN=Atpalpha PE=1 SV=3 95 1080 8.0E-165
sp|P30714|AT1A1_RHIMB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rhinella marina GN=ATP1A1 PE=1 SV=2 116 1080 9.0E-165
sp|P09626|ATP4A_RAT Potassium-transporting ATPase alpha chain 1 OS=Rattus norvegicus GN=Atp4a PE=1 SV=3 116 1078 1.0E-164
sp|D2WKD8|AT1A2_PIG Sodium/potassium-transporting ATPase subunit alpha-2 OS=Sus scrofa GN=ATP1A2 PE=1 SV=1 116 1080 1.0E-164
sp|A2VDL6|AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus GN=ATP1A2 PE=2 SV=1 116 1080 2.0E-164
sp|P54708|AT12A_RAT Potassium-transporting ATPase alpha chain 2 OS=Rattus norvegicus GN=Atp12a PE=1 SV=1 88 1078 3.0E-164
sp|Q9N0Z6|AT1A1_RABIT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oryctolagus cuniculus GN=ATP1A1 PE=1 SV=2 116 1080 3.0E-164
sp|P27112|ATP4A_RABIT Potassium-transporting ATPase alpha chain 1 OS=Oryctolagus cuniculus GN=ATP4A PE=2 SV=3 116 1078 8.0E-164
sp|P54707|AT12A_HUMAN Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens GN=ATP12A PE=1 SV=3 103 1078 1.0E-163
sp|P05025|AT1A_TORCA Sodium/potassium-transporting ATPase subunit alpha OS=Torpedo californica PE=1 SV=1 116 1080 3.0E-163
sp|P20648|ATP4A_HUMAN Potassium-transporting ATPase alpha chain 1 OS=Homo sapiens GN=ATP4A PE=2 SV=5 116 1078 3.0E-163
sp|Q9WV27|AT1A4_MOUSE Sodium/potassium-transporting ATPase subunit alpha-4 OS=Mus musculus GN=Atp1a4 PE=1 SV=3 116 1080 1.0E-162
sp|Q64541|AT1A4_RAT Sodium/potassium-transporting ATPase subunit alpha-4 OS=Rattus norvegicus GN=Atp1a4 PE=2 SV=1 116 1080 5.0E-162
sp|Q9Z1W8|AT12A_MOUSE Potassium-transporting ATPase alpha chain 2 OS=Mus musculus GN=Atp12a PE=1 SV=3 89 1078 8.0E-162
sp|Q64436|ATP4A_MOUSE Potassium-transporting ATPase alpha chain 1 OS=Mus musculus GN=Atp4a PE=1 SV=3 116 1078 8.0E-162
sp|P28774|AT1B_ARTSF Sodium/potassium-transporting ATPase subunit alpha-B OS=Artemia franciscana PE=2 SV=1 113 1080 1.0E-161
sp|Q92126|ATP4A_XENLA Potassium-transporting ATPase alpha chain 1 OS=Xenopus laevis GN=atp4a PE=2 SV=3 116 1078 2.0E-161
sp|P09572|AT1A1_CHICK Sodium/potassium-transporting ATPase subunit alpha-1 OS=Gallus gallus GN=ATP1A1 PE=2 SV=1 116 1080 3.0E-161
sp|Q9TV52|AT12A_RABIT Potassium-transporting ATPase alpha chain 2 OS=Oryctolagus cuniculus GN=ATP12A PE=2 SV=1 71 1078 4.0E-161
sp|P58312|AT1A3_OREMO Sodium/potassium-transporting ATPase subunit alpha-3 OS=Oreochromis mossambicus GN=atp1a3 PE=2 SV=1 113 1080 6.0E-161
sp|Q92123|AT1A1_XENLA Sodium/potassium-transporting ATPase subunit alpha-1 OS=Xenopus laevis GN=atp1a1 PE=2 SV=1 116 1080 1.0E-160
sp|Q13733|AT1A4_HUMAN Sodium/potassium-transporting ATPase subunit alpha-4 OS=Homo sapiens GN=ATP1A4 PE=1 SV=3 116 1080 2.0E-160
sp|P50997|AT1A1_CANLF Sodium/potassium-transporting ATPase subunit alpha-1 OS=Canis lupus familiaris GN=ATP1A1 PE=2 SV=1 116 1080 9.0E-160
sp|Q92030|AT1A1_ANGAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Anguilla anguilla GN=atp1a1 PE=2 SV=1 116 1080 1.0E-159
sp|P25489|AT1A1_CATCO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Catostomus commersonii GN=atp1a1 PE=2 SV=1 116 1080 1.0E-158
sp|Q9YH26|AT1A1_OREMO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oreochromis mossambicus GN=atp1a1 PE=2 SV=2 116 1080 7.0E-157
sp|Q92036|AT12A_RHIMB Potassium-transporting ATPase alpha chain 2 OS=Rhinella marina GN=ATP12A PE=2 SV=1 116 1078 7.0E-150
sp|Q73E41|BACA1_BACC1 Calcium-transporting ATPase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_0519 PE=1 SV=1 115 1072 7.0E-102
sp|P37278|ATCL_SYNE7 Calcium-transporting ATPase OS=Synechococcus elongatus (strain PCC 7942) GN=pacL PE=1 SV=2 115 1048 5.0E-101
sp|P13586|ATC1_YEAST Calcium-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMR1 PE=1 SV=1 113 1075 5.0E-93
sp|P37367|ATA1_SYNY3 Cation-transporting ATPase pma1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pma1 PE=3 SV=2 115 1057 9.0E-93
sp|O34431|ATCL_BACSU Calcium-transporting ATPase OS=Bacillus subtilis (strain 168) GN=yloB PE=1 SV=1 113 1055 3.0E-92
sp|Q9CFU9|LLCA1_LACLA Calcium-transporting ATPase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=yoaB PE=1 SV=1 130 1072 5.0E-89
sp|O43108|ATC1_YARLI Calcium-transporting ATPase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PMR1 PE=3 SV=1 79 1075 9.0E-89
sp|P9WPS9|CTPF_MYCTU Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpF PE=1 SV=1 115 1081 9.0E-89
sp|P9WPS8|CTPF_MYCTO Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpF PE=2 SV=1 115 1081 9.0E-89
sp|P63688|CTPF_MYCBO Probable cation-transporting ATPase F OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpF PE=3 SV=1 115 1081 9.0E-89
sp|Q8Y8Q5|LMCA1_LISMO Calcium-transporting ATPase lmo0841 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0841 PE=1 SV=1 113 919 1.0E-88
sp|O59868|ATC1_SCHPO Calcium-transporting ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmr1 PE=1 SV=1 189 1071 1.0E-87
sp|Q8R429|AT2A1_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Mus musculus GN=Atp2a1 PE=1 SV=1 116 1080 2.0E-86
sp|Q64578|AT2A1_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Rattus norvegicus GN=Atp2a1 PE=1 SV=1 116 1080 2.0E-86
sp|O14983|AT2A1_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Homo sapiens GN=ATP2A1 PE=1 SV=1 116 1081 8.0E-86
sp|P04191|AT2A1_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Oryctolagus cuniculus GN=ATP2A1 PE=1 SV=1 116 1081 9.0E-86
sp|Q64518|AT2A3_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Mus musculus GN=Atp2a3 PE=1 SV=3 116 1075 1.0E-85
sp|Q9XES1|ECA4_ARATH Calcium-transporting ATPase 4, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA4 PE=2 SV=2 125 1075 1.0E-85
sp|Q92105|AT2A1_PELES Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Pelophylax esculentus GN=ATP2A1 PE=2 SV=1 116 1080 3.0E-85
sp|P70083|AT2A1_MAKNI Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Makaira nigricans GN=atp2a1 PE=2 SV=2 116 1077 1.0E-84
sp|P92939|ECA1_ARATH Calcium-transporting ATPase 1, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA1 PE=1 SV=2 125 1075 2.0E-84
sp|Q93084|AT2A3_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Homo sapiens GN=ATP2A3 PE=1 SV=2 116 1075 2.0E-84
sp|Q9YGL9|AT2A3_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Gallus gallus GN=ATP2A3 PE=2 SV=1 116 1085 3.0E-84
sp|Q0VCY0|AT2A1_BOVIN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Bos taurus GN=ATP2A1 PE=1 SV=1 116 1080 2.0E-83
sp|P18596|AT2A3_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Rattus norvegicus GN=Atp2a3 PE=1 SV=2 116 1087 3.0E-83
sp|P98194|AT2C1_HUMAN Calcium-transporting ATPase type 2C member 1 OS=Homo sapiens GN=ATP2C1 PE=1 SV=3 201 1047 6.0E-83
sp|Q64566|AT2C1_RAT Calcium-transporting ATPase type 2C member 1 OS=Rattus norvegicus GN=Atp2c1 PE=2 SV=1 201 1047 9.0E-83
sp|Q9SY55|ECA3_ARATH Calcium-transporting ATPase 3, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA3 PE=2 SV=3 127 1075 1.0E-82
sp|P57709|AT2C1_BOVIN Calcium-transporting ATPase type 2C member 1 OS=Bos taurus GN=ATP2C1 PE=2 SV=1 201 1047 1.0E-82
sp|P13585|AT2A1_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Gallus gallus GN=ATP2A1 PE=2 SV=2 116 1077 4.0E-82
sp|Q5R5K5|AT2C1_PONAB Calcium-transporting ATPase type 2C member 1 OS=Pongo abelii GN=ATP2C1 PE=2 SV=1 201 1047 6.0E-82
sp|Q80XR2|AT2C1_MOUSE Calcium-transporting ATPase type 2C member 1 OS=Mus musculus GN=Atp2c1 PE=1 SV=2 218 1047 1.0E-81
sp|O55143|AT2A2_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Mus musculus GN=Atp2a2 PE=1 SV=2 116 1081 7.0E-81
sp|P16615|AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens GN=ATP2A2 PE=1 SV=1 116 1077 7.0E-81
sp|P54209|ATC1_DUNBI Cation-transporting ATPase CA1 OS=Dunaliella bioculata GN=CA1 PE=2 SV=1 134 1084 7.0E-81
sp|P20647|AT2A2_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Oryctolagus cuniculus GN=ATP2A2 PE=2 SV=2 116 1077 1.0E-80
sp|Q8R4C1|AT2C2_RAT Calcium-transporting ATPase type 2C member 2 OS=Rattus norvegicus GN=Atp2c2 PE=2 SV=1 117 1072 2.0E-80
sp|Q00779|AT2A2_FELCA Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Felis catus GN=ATP2A2 PE=2 SV=1 116 1077 2.0E-80
sp|P11607|AT2A2_PIG Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Sus scrofa GN=ATP2A2 PE=1 SV=1 116 1077 3.0E-80
sp|P11507|AT2A2_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Rattus norvegicus GN=Atp2a2 PE=1 SV=1 116 1077 4.0E-80
sp|O46674|AT2A2_CANLF Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Canis lupus familiaris GN=ATP2A2 PE=2 SV=1 116 1077 5.0E-80
sp|A7L9Z8|AT2C2_MOUSE Calcium-transporting ATPase type 2C member 2 OS=Mus musculus GN=Atp2c2 PE=2 SV=1 117 1072 6.0E-80
sp|Q42883|ECAP_SOLLC Calcium-transporting ATPase, endoplasmic reticulum-type OS=Solanum lycopersicum GN=LCA1 PE=2 SV=1 119 1075 3.0E-79
sp|Q292Q0|ATC1_DROPS Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila pseudoobscura pseudoobscura GN=Ca-P60A PE=3 SV=2 134 1085 4.0E-79
sp|P22700|ATC1_DROME Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila melanogaster GN=Ca-P60A PE=1 SV=2 134 1080 1.0E-78
sp|Q7PPA5|ATC1_ANOGA Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Anopheles gambiae GN=Ca-P60A PE=3 SV=5 116 1080 2.0E-78
sp|Q03669|AT2A2_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Gallus gallus GN=ATP2A2 PE=2 SV=2 116 1077 1.0E-77
sp|O75185|AT2C2_HUMAN Calcium-transporting ATPase type 2C member 2 OS=Homo sapiens GN=ATP2C2 PE=1 SV=2 217 944 2.0E-77
sp|P35315|ATC_TRYBB Probable calcium-transporting ATPase OS=Trypanosoma brucei brucei GN=TBA1 PE=3 SV=1 127 1080 7.0E-73
sp|O23087|ECA2_ARATH Calcium-transporting ATPase 2, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA2 PE=1 SV=1 202 1075 2.0E-68
sp|P35316|ATC_ARTSF Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Artemia franciscana PE=2 SV=1 116 1077 4.0E-68
sp|P22189|ATC3_SCHPO Calcium-transporting ATPase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta3 PE=1 SV=1 122 932 1.0E-66
sp|P13587|ATN1_YEAST Sodium transport ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA1 PE=1 SV=1 101 1079 1.0E-66
sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 123 914 2.0E-66
sp|Q01896|ATN2_YEAST Sodium transport ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA2 PE=1 SV=1 101 1079 8.0E-66
sp|P47317|ATCL_MYCGE Probable cation-transporting P-type ATPase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pacL PE=3 SV=1 202 847 4.0E-65
sp|O81108|ACA2_ARATH Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=ACA2 PE=1 SV=1 104 925 1.0E-64
sp|Q2QY12|ACA4_ORYSJ Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1 239 904 4.0E-64
sp|Q2RAS0|ACA5_ORYSJ Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1 239 904 6.0E-64
sp|Q65X71|ACA6_ORYSJ Probable calcium-transporting ATPase 6, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os05g0495600 PE=3 SV=1 239 904 5.0E-63
sp|Q9SZR1|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2 195 1055 6.0E-63
sp|Q2QMX9|ACA1_ORYSJ Calcium-transporting ATPase 1, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0586600 PE=2 SV=1 239 975 7.0E-63
sp|O64806|ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=3 SV=2 170 925 2.0E-62
sp|Q6ATV4|ACA2_ORYSJ Calcium-transporting ATPase 2, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os03g0616400 PE=2 SV=1 239 1028 2.0E-62
sp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=1 SV=1 195 904 7.0E-62
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 195 904 3.0E-61
sp|P78036|ATCL_MYCPN Probable cation-transporting P-type ATPase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pacL PE=3 SV=1 129 863 9.0E-61
sp|Q37145|ACA1_ARATH Calcium-transporting ATPase 1, chloroplastic OS=Arabidopsis thaliana GN=ACA1 PE=1 SV=3 239 914 2.0E-59
sp|P22036|ATMB_SALTY Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtB PE=1 SV=3 89 905 1.0E-57
sp|Q64542|AT2B4_RAT Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus GN=Atp2b4 PE=1 SV=1 113 1064 2.0E-56
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 204 1075 8.0E-56
sp|Q8RUN1|ACA3_ORYSJ Calcium-transporting ATPase 3, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os01g0939100 PE=2 SV=1 106 904 4.0E-55
sp|Q9LIK7|ACA13_ARATH Putative calcium-transporting ATPase 13, plasma membrane-type OS=Arabidopsis thaliana GN=ACA13 PE=3 SV=1 239 904 3.0E-54
sp|Q9HDW7|ATC2_SCHPO Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 239 845 3.0E-54
sp|Q6Q477|AT2B4_MOUSE Plasma membrane calcium-transporting ATPase 4 OS=Mus musculus GN=Atp2b4 PE=1 SV=1 111 1064 5.0E-54
sp|Q9LY77|ACA12_ARATH Calcium-transporting ATPase 12, plasma membrane-type OS=Arabidopsis thaliana GN=ACA12 PE=2 SV=1 204 904 6.0E-54
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 195 1083 3.0E-53
sp|P0ABB8|ATMA_ECOLI Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli (strain K12) GN=mgtA PE=1 SV=1 252 1071 3.0E-52
sp|P0ABB9|ATMA_ECO57 Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli O157:H7 GN=mgtA PE=3 SV=1 252 1071 3.0E-52
sp|P36640|ATMA_SALTY Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtA PE=2 SV=1 252 1071 2.0E-50
sp|D0ZTB2|ATMA_SALT1 Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=mgtA PE=2 SV=1 252 1071 2.0E-50
sp|Q58623|Y1226_METJA Putative cation-transporting ATPase MJ1226 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1226 PE=3 SV=1 118 884 8.0E-50
sp|Q9R0K7|AT2B2_MOUSE Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus GN=Atp2b2 PE=1 SV=2 199 1064 2.0E-49
sp|P11718|ATXA_LEIDO Probable proton ATPase 1A OS=Leishmania donovani GN=H1A PE=2 SV=2 132 849 5.0E-49
sp|P12522|ATXB_LEIDO Probable proton ATPase 1B OS=Leishmania donovani GN=H1B PE=2 SV=1 132 849 7.0E-49
sp|Q08853|ATC_PLAFK Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 548 1075 6.0E-48
sp|P23634|AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens GN=ATP2B4 PE=1 SV=2 404 1064 1.0E-47
sp|P20431|PMA3_ARATH ATPase 3, plasma membrane-type OS=Arabidopsis thaliana GN=AHA3 PE=1 SV=2 116 883 1.0E-47
sp|P19456|PMA2_ARATH ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=AHA2 PE=1 SV=2 116 883 4.0E-47
sp|Q7XPY2|PMA1_ORYSJ Plasma membrane ATPase OS=Oryza sativa subsp. japonica GN=Os04g0656100 PE=2 SV=1 121 883 1.0E-46
sp|Q43128|PMA10_ARATH ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=AHA10 PE=2 SV=2 112 985 2.0E-46
sp|Q9SU58|PMA4_ARATH ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=AHA4 PE=2 SV=2 121 985 2.0E-46
sp|Q9SH76|PMA6_ARATH ATPase 6, plasma membrane-type OS=Arabidopsis thaliana GN=AHA6 PE=2 SV=1 116 883 3.0E-46
sp|Q9M2A0|PMA8_ARATH ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=AHA8 PE=3 SV=1 116 845 3.0E-46
sp|P20649|PMA1_ARATH ATPase 1, plasma membrane-type OS=Arabidopsis thaliana GN=AHA1 PE=1 SV=3 116 889 6.0E-46
sp|P83970|PMA1_WHEAT Plasma membrane ATPase OS=Triticum aestivum GN=ha1 PE=2 SV=1 121 845 6.0E-46
sp|P07038|PMA1_NEUCR Plasma membrane ATPase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pma-1 PE=1 SV=1 102 884 7.0E-46
sp|D3K0R6|AT2B4_BOVIN Plasma membrane calcium-transporting ATPase 4 OS=Bos taurus GN=ATP2B4 PE=1 SV=2 404 1064 1.0E-45
sp|Q03194|PMA4_NICPL Plasma membrane ATPase 4 OS=Nicotiana plumbaginifolia GN=PMA4 PE=2 SV=1 116 883 2.0E-45
sp|P9WPS4|CTPI_MYCTO Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 250 1053 4.0E-45
sp|P54211|PMA1_DUNBI Plasma membrane ATPase OS=Dunaliella bioculata GN=PMA1 PE=2 SV=1 115 883 5.0E-45
sp|Q9LV11|PMA11_ARATH ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=AHA11 PE=1 SV=1 121 985 6.0E-45
sp|P28877|PMA1_CANAX Plasma membrane ATPase 1 OS=Candida albicans GN=PMA1 PE=1 SV=1 117 898 9.0E-45
sp|P05030|PMA1_YEAST Plasma membrane ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA1 PE=1 SV=2 125 884 2.0E-44
sp|P9WPS5|CTPI_MYCTU Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 250 924 3.0E-44
sp|Q08435|PMA1_NICPL Plasma membrane ATPase 1 OS=Nicotiana plumbaginifolia GN=PMA1 PE=2 SV=1 121 1048 3.0E-44
sp|Q12691|ATN5_YEAST Sodium transport ATPase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA5 PE=1 SV=1 541 1079 3.0E-44
sp|Q9SJB3|PMA5_ARATH ATPase 5, plasma membrane-type OS=Arabidopsis thaliana GN=AHA5 PE=3 SV=3 121 883 3.0E-44
sp|Q08436|PMA3_NICPL Plasma membrane ATPase 3 OS=Nicotiana plumbaginifolia GN=PMA3 PE=1 SV=1 134 985 4.0E-44
sp|Q42556|PMA9_ARATH ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=AHA9 PE=2 SV=2 112 1033 4.0E-44
sp|O53114|CTPI_MYCLE Probable cation-transporting ATPase I OS=Mycobacterium leprae (strain TN) GN=ctpI PE=3 SV=1 250 895 8.0E-44
sp|Q9LY32|PMA7_ARATH ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=AHA7 PE=2 SV=1 121 1034 3.0E-43
sp|P22180|PMA1_SOLLC Plasma membrane ATPase 1 OS=Solanum lycopersicum GN=LHA1 PE=2 SV=1 121 985 8.0E-43
sp|Q64568|AT2B3_RAT Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus GN=Atp2b3 PE=1 SV=2 404 1064 2.0E-42
sp|P19657|PMA2_YEAST Plasma membrane ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA2 PE=1 SV=3 125 884 5.0E-42
sp|Q16720|AT2B3_HUMAN Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens GN=ATP2B3 PE=1 SV=3 404 1064 6.0E-42
sp|P11505|AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 404 1069 1.0E-41
sp|G5E829|AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 404 1069 1.0E-41
sp|P24545|PMA1_ZYGRO Plasma membrane ATPase OS=Zygosaccharomyces rouxii PE=3 SV=1 120 884 2.0E-41
sp|P23220|AT2B1_PIG Plasma membrane calcium-transporting ATPase 1 OS=Sus scrofa GN=ATP2B1 PE=2 SV=1 404 1069 4.0E-41
sp|P20020|AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 404 1069 5.0E-41
sp|P49380|PMA1_KLULA Plasma membrane ATPase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PMA1 PE=1 SV=1 96 884 1.0E-40
sp|P11506|AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=2 404 1064 2.0E-40
sp|P54210|PMA1_DUNAC Plasma membrane ATPase OS=Dunaliella acidophila GN=DHA1 PE=2 SV=1 79 883 3.0E-40
sp|Q01814|AT2B2_HUMAN Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2 404 1064 5.0E-40
sp|Q07421|PMA1_AJECA Plasma membrane ATPase OS=Ajellomyces capsulatus GN=PMA1 PE=3 SV=1 120 884 7.0E-39
sp|P54679|PMA1_DICDI Probable plasma membrane ATPase OS=Dictyostelium discoideum GN=patB PE=2 SV=2 121 849 8.0E-39
sp|P58165|AT2B2_OREMO Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 404 1064 4.0E-37
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 404 1069 6.0E-37
sp|P09627|PMA1_SCHPO Plasma membrane ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma1 PE=1 SV=1 102 884 1.0E-36
sp|P28876|PMA2_SCHPO Plasma membrane ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma2 PE=3 SV=1 117 884 2.0E-36
sp|P38929|ATC2_YEAST Calcium-transporting ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMC1 PE=1 SV=1 548 1037 3.0E-34
sp|P9WPT0|CTPE_MYCTO Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpE PE=3 SV=1 218 866 8.0E-29
sp|P9WPT1|CTPE_MYCTU Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpE PE=1 SV=1 218 866 9.0E-29
sp|P0A505|CTPE_MYCBO Probable cation-transporting ATPase E OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpE PE=3 SV=1 218 866 9.0E-29
sp|Q08853|ATC_PLAFK Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 116 455 2.0E-28
sp|Q12691|ATN5_YEAST Sodium transport ATPase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA5 PE=1 SV=1 101 467 2.0E-27
sp|P23980|PMA2_SOLLC Plasma membrane ATPase 2 (Fragment) OS=Solanum lycopersicum GN=LHA2 PE=3 SV=1 397 985 7.0E-27
sp|Q5ZKB7|AT134_CHICK Probable cation-transporting ATPase 13A4 OS=Gallus gallus GN=ATP13A4 PE=2 SV=1 241 833 1.0E-25
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 124 846 2.0E-25
sp|P35597|EXP7_STRPN Probable cation-transporting ATPase exp7 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp7 PE=3 SV=2 206 862 2.0E-25
sp|O14072|ATC4_SCHPO Manganese-transporting ATPase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta4 PE=3 SV=1 104 808 6.0E-24
sp|Q4VNC1|AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens GN=ATP13A4 PE=2 SV=3 241 833 4.0E-23
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 166 904 6.0E-23
sp|Q9NQ11|AT132_HUMAN Probable cation-transporting ATPase 13A2 OS=Homo sapiens GN=ATP13A2 PE=1 SV=2 201 846 8.0E-23
sp|Q27533|YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans GN=W08D2.5 PE=3 SV=2 239 813 4.0E-22
sp|Q9T0E0|PMAX_ARATH Putative ATPase, plasma membrane-like OS=Arabidopsis thaliana GN=At4g11730 PE=3 SV=1 116 582 2.0E-21
sp|Q4VNC0|AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens GN=ATP13A5 PE=2 SV=1 237 850 8.0E-20
sp|Q12697|YPK9_YEAST Vacuolar cation-transporting ATPase YPK9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK9 PE=1 SV=1 239 833 2.0E-18
sp|Q3TYU2|AT135_MOUSE Probable cation-transporting ATPase 13A5 OS=Mus musculus GN=Atp13a5 PE=2 SV=2 237 850 2.0E-18
sp|Q5XF90|AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus GN=Atp13a4 PE=2 SV=1 241 833 3.0E-18
sp|Q9LT02|PDR2_ARATH Probable manganese-transporting ATPase PDR2 OS=Arabidopsis thaliana GN=PDR2 PE=1 SV=1 238 805 6.0E-18
sp|P39986|ATC6_YEAST Manganese-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPF1 PE=1 SV=1 166 812 2.0E-17
sp|Q5XF89|AT133_MOUSE Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 78 803 3.0E-17
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 142 895 3.0E-17
sp|O14022|CTA5_SCHPO Cation-transporting ATPase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta5 PE=3 SV=1 234 803 1.0E-16
sp|P38929|ATC2_YEAST Calcium-transporting ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMC1 PE=1 SV=1 121 464 2.0E-16
sp|P90747|AT131_CAEEL Probable manganese-transporting ATPase catp-8 OS=Caenorhabditis elegans GN=catp-8 PE=3 SV=3 239 806 2.0E-16
sp|Q8XU11|KDPB_RALSO Potassium-transporting ATPase ATP-binding subunit OS=Ralstonia solanacearum (strain GMI1000) GN=kdpB PE=3 SV=1 149 833 3.0E-16
sp|P73241|ATCS_SYNY3 Probable copper-transporting ATPase PacS OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pacS PE=1 SV=1 648 841 4.0E-16
sp|Q9ZHC7|SILP_SALTM Silver exporting P-type ATPase OS=Salmonella typhimurium GN=silP PE=1 SV=1 562 841 4.0E-15
sp|O74431|ATC9_SCHPO Probable cation-transporting ATPase C1672.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.11c PE=3 SV=1 134 833 6.0E-15
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 250 804 8.0E-15
sp|P32113|COPA_ENTHA Probable copper-importing P-type ATPase A OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copA PE=1 SV=2 651 892 3.0E-14
sp|Q9SH30|HMA5_ARATH Probable copper-transporting ATPase HMA5 OS=Arabidopsis thaliana GN=HMA5 PE=1 SV=2 758 840 4.0E-14
sp|Q9KPZ7|COPA_VIBCH Copper-exporting P-type ATPase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=copA PE=3 SV=1 758 841 5.0E-14
sp|Q9H7F0|AT133_HUMAN Probable cation-transporting ATPase 13A3 OS=Homo sapiens GN=ATP13A3 PE=1 SV=4 124 803 6.0E-14
sp|O32220|COPA_BACSU Copper-exporting P-type ATPase A OS=Bacillus subtilis (strain 168) GN=copA PE=1 SV=2 758 892 6.0E-14
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 181 865 9.0E-14
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 250 888 2.0E-13
sp|P9WPS3|CTPV_MYCTU Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpV PE=1 SV=1 756 865 3.0E-13
sp|P9WPS2|CTPV_MYCTO Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpV PE=3 SV=1 756 865 3.0E-13
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 150 882 3.0E-13
sp|P37279|ATCS_SYNE7 Probable copper-transporting ATPase PacS OS=Synechococcus elongatus (strain PCC 7942) GN=pacS PE=3 SV=2 758 841 6.0E-13
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 548 895 7.0E-13
sp|Q9X5V3|ATCU_RHILV Copper-transporting P-type ATPase OS=Rhizobium leguminosarum bv. viciae GN=actP PE=1 SV=1 646 845 7.0E-13
sp|P59219|KDPB_LEPIN Potassium-transporting ATPase ATP-binding subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=kdpB PE=3 SV=2 253 873 9.0E-13
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 441 942 1.0E-12
sp|O32619|COPA_HELFC Copper-transporting ATPase OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=copA PE=3 SV=1 760 841 2.0E-12
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 544 895 2.0E-12
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 438 865 2.0E-12
sp|O29777|COPA_ARCFU Probable copper-exporting P-type ATPase A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copA PE=1 SV=1 742 907 3.0E-12
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 150 942 3.0E-12
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 548 895 4.0E-12
sp|Q9S7J8|HMA7_ARATH Copper-transporting ATPase RAN1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 728 866 4.0E-12
sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=actP PE=1 SV=1 193 461 4.0E-12
sp|Q9XT50|ATP7B_SHEEP Copper-transporting ATPase 2 OS=Ovis aries GN=ATP7B PE=2 SV=1 758 833 7.0E-12
sp|Q72TM6|KDPB_LEPIC Potassium-transporting ATPase ATP-binding subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=kdpB PE=3 SV=1 253 873 9.0E-12
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 548 895 9.0E-12
sp|O31688|ZOSA_BACSU Zinc-transporting ATPase OS=Bacillus subtilis (strain 168) GN=zosA PE=1 SV=1 741 847 1.0E-11
sp|Q927G0|KDPB1_LISIN Potassium-transporting ATPase ATP-binding subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kdpB1 PE=3 SV=1 759 927 1.0E-11
sp|B8DAW1|KDPB_LISMH Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=kdpB PE=3 SV=1 759 866 1.0E-11
sp|Q8Y3Z7|KDPB_LISMO Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=kdpB PE=3 SV=1 759 927 1.0E-11
sp|Q71W90|KDPB_LISMF Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4b (strain F2365) GN=kdpB PE=3 SV=1 759 866 1.0E-11
sp|C1KZN5|KDPB_LISMC Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=kdpB PE=3 SV=1 759 866 1.0E-11
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 548 895 1.0E-11
sp|A0AM16|KDPB_LISW6 Potassium-transporting ATPase ATP-binding subunit OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=kdpB PE=3 SV=1 759 866 1.0E-11
sp|P35670|ATP7B_HUMAN Copper-transporting ATPase 2 OS=Homo sapiens GN=ATP7B PE=1 SV=4 758 833 1.0E-11
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 548 895 1.0E-11
sp|Q64446|ATP7B_MOUSE Copper-transporting ATPase 2 OS=Mus musculus GN=Atp7b PE=1 SV=2 758 833 1.0E-11
sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti (strain 1021) GN=actP2 PE=3 SV=1 758 864 2.0E-11
sp|Q64535|ATP7B_RAT Copper-transporting ATPase 2 OS=Rattus norvegicus GN=Atp7b PE=1 SV=1 758 833 2.0E-11
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 441 803 2.0E-11
sp|P57699|KDPB_HALSA Potassium-transporting ATPase ATP-binding subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=kdpB PE=3 SV=1 648 833 2.0E-11
sp|B0R9M0|KDPB_HALS3 Potassium-transporting ATPase ATP-binding subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=kdpB PE=2 SV=1 648 833 2.0E-11
sp|D3K0R6|AT2B4_BOVIN Plasma membrane calcium-transporting ATPase 4 OS=Bos taurus GN=ATP2B4 PE=1 SV=2 122 339 3.0E-11
sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=actP PE=1 SV=1 758 841 3.0E-11
sp|P9WPU1|CTPA_MYCTU Cation-transporting P-type ATPase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpA PE=1 SV=1 758 840 3.0E-11
sp|P9WPU0|CTPA_MYCTO Cation-transporting P-type ATPase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpA PE=3 SV=1 758 840 3.0E-11
sp|Q9A7X7|KDPB_CAUCR Potassium-transporting ATPase ATP-binding subunit OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=kdpB PE=3 SV=1 648 833 3.0E-11
sp|P73867|KDPB_SYNY3 Potassium-transporting ATPase ATP-binding subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=kdpB PE=3 SV=1 174 866 3.0E-11
sp|P32113|COPA_ENTHA Probable copper-importing P-type ATPase A OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copA PE=1 SV=2 203 467 4.0E-11
sp|Q59385|COPA_ECOLI Copper-exporting P-type ATPase A OS=Escherichia coli (strain K12) GN=copA PE=1 SV=4 611 876 4.0E-11
sp|P07893|ATSY_SYNP6 Probable copper-transporting ATPase SynA OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=synA PE=3 SV=2 706 845 4.0E-11
sp|P37385|ATSY_SYNE7 Probable copper-transporting ATPase SynA OS=Synechococcus elongatus (strain PCC 7942) GN=synA PE=3 SV=1 706 845 4.0E-11
sp|P49015|ATP7A_CRIGR Copper-transporting ATPase 1 (Fragment) OS=Cricetulus griseus GN=ATP7A PE=2 SV=1 758 876 5.0E-11
sp|P11506|AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=2 199 339 7.0E-11
sp|Q926K7|KDPB2_LISIN Potassium-transporting ATPase ATP-binding subunit 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kdpB2 PE=3 SV=1 759 833 7.0E-11
sp|Q9CCL1|CTPC_MYCLE Probable cation-transporting P-type ATPase C OS=Mycobacterium leprae (strain TN) GN=ctpC PE=3 SV=1 648 832 8.0E-11
sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti (strain 1021) GN=actP2 PE=3 SV=1 193 461 9.0E-11
sp|P9WPT3|CTPD_MYCTU Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpD PE=3 SV=1 204 482 9.0E-11
sp|P9WPT2|CTPD_MYCTO Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpD PE=3 SV=1 204 482 9.0E-11
sp|P63686|CTPD_MYCBO Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpD PE=3 SV=1 204 482 9.0E-11
sp|P23634|AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens GN=ATP2B4 PE=1 SV=2 113 339 1.0E-10
sp|B4U8E4|KDPB_HYDS0 Potassium-transporting ATPase ATP-binding subunit OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=kdpB PE=3 SV=1 648 836 1.0E-10
sp|Q4A0G1|COPA_STAS1 Copper-exporting P-type ATPase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=copA PE=3 SV=1 221 482 1.0E-10
sp|Q8Z8S4|COPA_SALTI Copper-exporting P-type ATPase A OS=Salmonella typhi GN=copA PE=3 SV=3 593 876 1.0E-10
sp|Q8ZR95|COPA_SALTY Copper-exporting P-type ATPase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=copA PE=1 SV=3 593 876 1.0E-10
sp|B2TMJ2|KDPB_CLOBB Potassium-transporting ATPase ATP-binding subunit OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=kdpB PE=3 SV=1 759 873 1.0E-10
sp|B2V2P3|KDPB_CLOBA Potassium-transporting ATPase ATP-binding subunit OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=kdpB PE=3 SV=1 759 873 1.0E-10
sp|Q8ZCA7|COPA_YERPE Copper-exporting P-type ATPase A OS=Yersinia pestis GN=copA PE=3 SV=1 758 841 1.0E-10
sp|P77868|Y290_HAEIN Probable cation-transporting ATPase HI_0290 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0290 PE=3 SV=1 759 892 1.0E-10
sp|O59666|ATU2_SCHPO Copper-transporting ATPase ccc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccc2 PE=3 SV=1 648 874 1.0E-10
sp|Q01814|AT2B2_HUMAN Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2 199 339 2.0E-10
sp|Q64430|ATP7A_MOUSE Copper-transporting ATPase 1 OS=Mus musculus GN=Atp7a PE=1 SV=3 758 833 2.0E-10
sp|Q04656|ATP7A_HUMAN Copper-transporting ATPase 1 OS=Homo sapiens GN=ATP7A PE=1 SV=3 758 833 2.0E-10
sp|P55989|COPA_HELPY Copper-transporting ATPase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=copA PE=3 SV=1 760 841 2.0E-10
sp|Q59467|COPA2_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=1 760 841 2.0E-10
sp|P46839|CTPA_MYCLE Cation-transporting P-type ATPase A OS=Mycobacterium leprae (strain TN) GN=ctpA PE=3 SV=2 758 825 2.0E-10
sp|P77871|COPA1_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=2 760 841 2.0E-10
sp|Q9ZM69|COPA_HELPJ Copper-transporting ATPase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=copA PE=3 SV=1 760 841 2.0E-10
sp|P70705|ATP7A_RAT Copper-transporting ATPase 1 OS=Rattus norvegicus GN=Atp7a PE=1 SV=1 758 876 3.0E-10
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 182 865 3.0E-10
sp|Q0TRT3|KDPB_CLOP1 Potassium-transporting ATPase ATP-binding subunit OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=kdpB PE=3 SV=1 759 833 3.0E-10
sp|A0R3A7|CTPD_MYCS2 Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ctpD PE=1 SV=1 204 482 3.0E-10
sp|Q16720|AT2B3_HUMAN Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens GN=ATP2B3 PE=1 SV=3 199 339 4.0E-10
sp|O31688|ZOSA_BACSU Zinc-transporting ATPase OS=Bacillus subtilis (strain 168) GN=zosA PE=1 SV=1 204 467 4.0E-10
sp|Q6GIX4|COPB_STAAR Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain MRSA252) GN=copB PE=3 SV=1 712 882 4.0E-10
sp|Q64568|AT2B3_RAT Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus GN=Atp2b3 PE=1 SV=2 199 339 5.0E-10
sp|Q69HU0|COPB_STAAU Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus GN=copB PE=3 SV=1 712 882 5.0E-10
sp|Q8XD24|COPA_ECO57 Copper-exporting P-type ATPase A OS=Escherichia coli O157:H7 GN=copA PE=3 SV=3 758 876 5.0E-10
sp|O08462|COPA3_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=1 760 841 5.0E-10
sp|P58341|ATCU1_RHIME Copper-transporting ATPase 1 OS=Rhizobium meliloti (strain 1021) GN=actP1 PE=3 SV=1 758 841 6.0E-10
sp|Q8CN02|COPA_STAES Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copA PE=3 SV=1 203 465 7.0E-10
sp|Q5HL56|COPA_STAEQ Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copA PE=3 SV=1 203 465 7.0E-10
sp|P63684|KDPB2_STAAN Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain N315) GN=kdpB2 PE=3 SV=1 760 833 7.0E-10
sp|P63683|KDPB2_STAAM Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB2 PE=3 SV=1 760 833 7.0E-10
sp|Q8NVI2|KDPB_STAAW Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MW2) GN=kdpB PE=3 SV=1 760 833 7.0E-10
sp|A8Z4X9|KDPB_STAAT Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=kdpB PE=3 SV=1 760 833 7.0E-10
sp|Q6G7N3|KDPB_STAAS Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MSSA476) GN=kdpB PE=3 SV=1 760 833 7.0E-10
sp|A6QIS1|KDPB_STAAE Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain Newman) GN=kdpB PE=3 SV=1 760 833 7.0E-10
sp|Q5HEC4|KDPB_STAAC Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain COL) GN=kdpB PE=3 SV=1 760 833 7.0E-10
sp|Q2YUH7|KDPB_STAAB Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=kdpB PE=3 SV=1 760 833 8.0E-10
sp|Q6GEZ7|KDPB2_STAAR Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB2 PE=3 SV=1 760 833 8.0E-10
sp|Q93MV5|KDPB_MYXXA Potassium-transporting ATPase ATP-binding subunit OS=Myxococcus xanthus GN=kdpB PE=3 SV=1 759 878 9.0E-10
sp|P58341|ATCU1_RHIME Copper-transporting ATPase 1 OS=Rhizobium meliloti (strain 1021) GN=actP1 PE=3 SV=1 193 481 1.0E-09
sp|Q2YWA3|COPA_STAAB Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=copA PE=3 SV=1 201 511 1.0E-09
sp|A8YZ02|COPB_STAAT Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copB PE=3 SV=1 710 892 1.0E-09
sp|Q2FKI2|COPB_STAA3 Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300) GN=copB PE=3 SV=1 710 892 1.0E-09
sp|Q5HKB0|COPB_STAEQ Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copB PE=3 SV=2 710 892 1.0E-09
sp|Q6GDP1|COPA_STAAR Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MRSA252) GN=copA PE=3 SV=1 756 819 1.0E-09
sp|O64474|HMA4_ARATH Putative cadmium/zinc-transporting ATPase HMA4 OS=Arabidopsis thaliana GN=HMA4 PE=1 SV=2 756 897 1.0E-09
sp|Q8CQF7|COPB_STAES Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copB PE=3 SV=1 710 882 1.0E-09
sp|A8Z3F8|COPA_STAAT Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copA PE=3 SV=1 756 819 1.0E-09
sp|Q2FDV0|COPA_STAA3 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300) GN=copA PE=3 SV=1 756 819 1.0E-09
sp|Q8NUQ9|COPA_STAAW Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MW2) GN=copA PE=3 SV=1 756 819 1.0E-09
sp|Q6G6B7|COPA_STAAS Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MSSA476) GN=copA PE=3 SV=1 756 819 1.0E-09
sp|Q7A3E6|COPA_STAAN Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain N315) GN=copA PE=1 SV=1 756 819 1.0E-09
sp|Q99R80|COPA_STAAM Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=copA PE=3 SV=1 756 819 1.0E-09
sp|A5IVY3|COPA_STAA9 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH9) GN=copA PE=3 SV=1 756 819 1.0E-09
sp|A6U4T8|COPA_STAA2 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH1) GN=copA PE=3 SV=1 756 819 1.0E-09
sp|A7X6S1|COPA_STAA1 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=copA PE=3 SV=1 756 819 1.0E-09
sp|P11505|AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 123 347 2.0E-09
sp|G5E829|AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 123 347 2.0E-09
sp|P20020|AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 123 347 2.0E-09
sp|Q9S7J8|HMA7_ARATH Copper-transporting ATPase RAN1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 164 477 2.0E-09
sp|Q2YWA3|COPA_STAAB Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=copA PE=3 SV=1 756 819 2.0E-09
sp|Q6GDP1|COPA_STAAR Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MRSA252) GN=copA PE=3 SV=1 201 511 2.0E-09
sp|A8Z3F8|COPA_STAAT Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copA PE=3 SV=1 201 511 2.0E-09
sp|Q2FDV0|COPA_STAA3 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300) GN=copA PE=3 SV=1 201 511 2.0E-09
sp|A6QK47|COPA_STAAE Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Newman) GN=copA PE=3 SV=1 756 819 2.0E-09
sp|A6QK47|COPA_STAAE Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Newman) GN=copA PE=3 SV=1 201 511 2.0E-09
sp|Q5HCZ3|COPA_STAAC Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain COL) GN=copA PE=3 SV=1 756 819 2.0E-09
sp|Q5HCZ3|COPA_STAAC Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain COL) GN=copA PE=3 SV=1 201 511 2.0E-09
sp|Q2FV64|COPA_STAA8 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain NCTC 8325) GN=copA PE=1 SV=1 756 819 2.0E-09
sp|Q2FV64|COPA_STAA8 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain NCTC 8325) GN=copA PE=1 SV=1 201 511 2.0E-09
sp|P9WPT9|CTPB_MYCTU Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpB PE=1 SV=1 764 840 2.0E-09
sp|P9WPT8|CTPB_MYCTO Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpB PE=3 SV=1 764 840 2.0E-09
sp|P59947|CTPB_MYCBO Cation-transporting P-type ATPase B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpB PE=3 SV=1 764 840 2.0E-09
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 182 865 2.0E-09
sp|P23220|AT2B1_PIG Plasma membrane calcium-transporting ATPase 1 OS=Sus scrofa GN=ATP2B1 PE=2 SV=1 123 347 3.0E-09
sp|Q8CN02|COPA_STAES Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copA PE=3 SV=1 756 819 3.0E-09
sp|Q5HL56|COPA_STAEQ Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copA PE=3 SV=1 756 819 3.0E-09
sp|Q4LAB1|COPB_STAHJ Probable copper-transporting P-type ATPase B OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copB PE=3 SV=2 710 882 3.0E-09
sp|Q8YPE9|KDPB1_NOSS1 Potassium-transporting ATPase ATP-binding subunit 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB1 PE=3 SV=1 759 833 3.0E-09
sp|P46840|CTPB_MYCLE Cation-transporting P-type ATPase B OS=Mycobacterium leprae (strain TN) GN=ctpB PE=3 SV=2 756 840 3.0E-09
sp|Q9R6X1|KDPB_ANASL Potassium-transporting ATPase ATP-binding subunit OS=Anabaena sp. (strain L31) GN=kdpB PE=3 SV=1 759 833 3.0E-09
sp|Q8NUQ9|COPA_STAAW Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MW2) GN=copA PE=3 SV=1 201 511 4.0E-09
sp|Q6G6B7|COPA_STAAS Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MSSA476) GN=copA PE=3 SV=1 201 511 4.0E-09
sp|B7HWG1|KDPB_BACC7 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH187) GN=kdpB PE=3 SV=1 760 833 4.0E-09
sp|Q6HN78|KDPB_BACHK Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=kdpB PE=3 SV=1 760 833 4.0E-09
sp|A0RA13|KDPB_BACAH Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis (strain Al Hakam) GN=kdpB PE=3 SV=1 760 833 4.0E-09
sp|Q81HQ0|KDPB_BACCR Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=kdpB PE=3 SV=1 760 833 4.0E-09
sp|A9VFM1|KDPB_BACWK Potassium-transporting ATPase ATP-binding subunit OS=Bacillus weihenstephanensis (strain KBAB4) GN=kdpB PE=3 SV=1 760 833 4.0E-09
sp|B7HDF9|KDPB_BACC4 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain B4264) GN=kdpB PE=3 SV=1 760 833 4.0E-09
sp|B7JRB8|KDPB_BACC0 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH820) GN=kdpB PE=3 SV=1 760 833 4.0E-09
sp|Q5HK64|KDPB_STAEQ Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=kdpB PE=3 SV=1 760 820 4.0E-09
sp|Q6GKN3|KDPB1_STAAR Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB1 PE=3 SV=1 760 820 4.0E-09
sp|P0A008|KDPB1_STAAN Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain N315) GN=kdpB1 PE=3 SV=1 760 820 4.0E-09
sp|P0A007|KDPB1_STAAM Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB1 PE=3 SV=1 760 820 4.0E-09
sp|B7II09|KDPB_BACC2 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain G9842) GN=kdpB PE=3 SV=1 760 833 4.0E-09
sp|C3LF99|KDPB_BACAC Potassium-transporting ATPase ATP-binding subunit OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=kdpB PE=3 SV=1 760 833 4.0E-09
sp|Q4LAI2|KDPB_STAHJ Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus haemolyticus (strain JCSC1435) GN=kdpB PE=3 SV=1 760 820 4.0E-09
sp|C1EYK0|KDPB_BACC3 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain 03BB102) GN=kdpB PE=3 SV=1 760 833 4.0E-09
sp|Q7A3E6|COPA_STAAN Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain N315) GN=copA PE=1 SV=1 203 511 5.0E-09
sp|Q99R80|COPA_STAAM Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=copA PE=3 SV=1 203 511 5.0E-09
sp|A5IVY3|COPA_STAA9 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH9) GN=copA PE=3 SV=1 203 511 5.0E-09
sp|A6U4T8|COPA_STAA2 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH1) GN=copA PE=3 SV=1 203 511 5.0E-09
sp|A7X6S1|COPA_STAA1 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=copA PE=3 SV=1 203 511 5.0E-09
sp|Q63FR0|KDPB_BACCZ Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ZK / E33L) GN=kdpB PE=3 SV=1 760 833 5.0E-09
sp|Q8R8I6|KDPB_CALS4 Potassium-transporting ATPase ATP-binding subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=kdpB PE=3 SV=1 759 833 5.0E-09
sp|P38995|ATU2_YEAST Copper-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCC2 PE=1 SV=1 756 869 5.0E-09
sp|P30336|CADA_BACPE Probable cadmium-transporting ATPase OS=Bacillus pseudofirmus (strain OF4) GN=cadA PE=3 SV=2 204 478 5.0E-09
sp|Q8U9D9|KDPB_AGRFC Potassium-transporting ATPase ATP-binding subunit OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=kdpB PE=3 SV=2 759 878 5.0E-09
sp|Q8KU73|KDPB_ENTFA Potassium-transporting ATPase ATP-binding subunit OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=kdpB PE=3 SV=1 759 833 5.0E-09
sp|Q98GX6|KDPB_RHILO Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium loti (strain MAFF303099) GN=kdpB PE=3 SV=1 759 867 5.0E-09
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 215 347 6.0E-09
sp|B9DFX7|HMA8_ARATH Copper-transporting ATPase PAA2, chloroplastic OS=Arabidopsis thaliana GN=PAA2 PE=2 SV=1 755 845 6.0E-09
sp|Q7N6W6|KDPB_PHOLL Potassium-transporting ATPase ATP-binding subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=kdpB PE=3 SV=1 759 833 6.0E-09
sp|Q4A0G1|COPA_STAS1 Copper-exporting P-type ATPase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=copA PE=3 SV=1 756 819 7.0E-09
sp|Q4L970|COPA_STAHJ Copper-exporting P-type ATPase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copA PE=3 SV=1 201 461 7.0E-09
sp|Q95050|ATX9_TETTH Probable cation-transporting ATPase 9 OS=Tetrahymena thermophila GN=TPA9 PE=2 SV=1 242 802 7.0E-09
sp|Q6GIX1|CADA_STAAR Probable cadmium-transporting ATPase OS=Staphylococcus aureus (strain MRSA252) GN=cadA PE=3 SV=1 199 478 7.0E-09
sp|P05425|COPB_ENTHA Copper-exporting P-type ATPase B OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copB PE=1 SV=2 202 478 8.0E-09
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 441 884 8.0E-09
sp|C4LDL7|KDPB_TOLAT Potassium-transporting ATPase ATP-binding subunit OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=kdpB PE=3 SV=1 759 833 8.0E-09
sp|A6T6D8|KDPB_KLEP7 Potassium-transporting ATPase ATP-binding subunit OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=kdpB PE=3 SV=1 759 833 9.0E-09
sp|B5XZE9|KDPB_KLEP3 Potassium-transporting ATPase ATP-binding subunit OS=Klebsiella pneumoniae (strain 342) GN=kdpB PE=3 SV=1 759 833 9.0E-09
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 182 865 9.0E-09
sp|B2VJK3|KDPB_ERWT9 Potassium-transporting ATPase ATP-binding subunit OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=kdpB PE=3 SV=1 759 878 9.0E-09
sp|Q8YSD5|KDPB2_NOSS1 Potassium-transporting ATPase ATP-binding subunit 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB2 PE=3 SV=1 759 833 9.0E-09
sp|B1JR96|KDPB_YERPY Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=kdpB PE=3 SV=1 759 833 9.0E-09
sp|A7FFQ9|KDPB_YERP3 Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=kdpB PE=3 SV=1 759 833 9.0E-09
sp|Q667S4|KDPB_YERPS Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|A7GLG4|KDPB_BACCN Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=kdpB PE=3 SV=1 760 833 1.0E-08
sp|P20021|CADA1_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 199 478 1.0E-08
sp|B7N9U0|KDPB_ECOLU Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|A4TL06|KDPB_YERPP Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis (strain Pestoides F) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|Q1CKH2|KDPB_YERPN Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|A9R3X3|KDPB_YERPG Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Angola) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|Q8ZD97|KDPB_YERPE Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|B2KA78|KDPB_YERPB Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|Q1C586|KDPB_YERPA Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|P03960|KDPB_ECOLI Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12) GN=kdpB PE=1 SV=3 759 833 1.0E-08
sp|B1X6M8|KDPB_ECODH Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12 / DH10B) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|C4ZWH3|KDPB_ECOBW Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|B1IY32|KDPB_ECOLC Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|O32328|KDPB_CLOAB Potassium-transporting ATPase ATP-binding subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=kdpB PE=3 SV=2 759 833 1.0E-08
sp|B7LKR7|KDPB_ESCF3 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|B6HYQ5|KDPB_ECOSE Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain SE11) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|B7NMQ0|KDPB_ECO7I Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|A7ZJ80|KDPB_ECO24 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 441 808 1.0E-08
sp|Q1REM0|KDPB_ECOUT Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain UTI89 / UPEC) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|A1A8W1|KDPB_ECOK1 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O1:K1 / APEC GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|B7M5L3|KDPB_ECO8A Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O8 (strain IAI1) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|B7LAA4|KDPB_ECO55 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain 55989 / EAEC) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|B7MFW2|KDPB_ECO45 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|Q3Z4A6|KDPB_SHISS Potassium-transporting ATPase ATP-binding subunit OS=Shigella sonnei (strain Ss046) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|B1LLE1|KDPB_ECOSM Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|Q8FJV4|KDPB_ECOL6 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|Q0TJY9|KDPB_ECOL5 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|B7MPK0|KDPB_ECO81 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O81 (strain ED1a) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|B7UKX6|KDPB_ECO27 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|A7ZXV8|KDPB_ECOHS Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O9:H4 (strain HS) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|A1JQS2|KDPB_YERE8 Potassium-transporting ATPase ATP-binding subunit OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|Q92XJ0|KDPB_RHIME Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium meliloti (strain 1021) GN=kdpB PE=3 SV=1 642 833 1.0E-08
sp|B5YQN9|KDPB_ECO5E Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|Q8X9F9|KDPB_ECO57 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O157:H7 GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|Q57RN0|KDPB_SALCH Potassium-transporting ATPase ATP-binding subunit OS=Salmonella choleraesuis (strain SC-B67) GN=kdpB PE=3 SV=1 651 833 1.0E-08
sp|B5EZE3|KDPB_SALA4 Potassium-transporting ATPase ATP-binding subunit OS=Salmonella agona (strain SL483) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|B4TQ22|KDPB_SALSV Potassium-transporting ATPase ATP-binding subunit OS=Salmonella schwarzengrund (strain CVM19633) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|Q8ZQW2|KDPB_SALTY Potassium-transporting ATPase ATP-binding subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|B5BCA4|KDPB_SALPK Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain AKU_12601) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|Q5PCJ7|KDPB_SALPA Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|Q8Z8E5|KDPB_SALTI Putative potassium-transporting ATPase ATP-binding subunit OS=Salmonella typhi GN=kdpB PE=5 SV=1 759 833 1.0E-08
sp|B4SZB1|KDPB_SALNS Potassium-transporting ATPase ATP-binding subunit OS=Salmonella newport (strain SL254) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|B4TBA6|KDPB_SALHS Potassium-transporting ATPase ATP-binding subunit OS=Salmonella heidelberg (strain SL476) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|B5QWE9|KDPB_SALEP Potassium-transporting ATPase ATP-binding subunit OS=Salmonella enteritidis PT4 (strain P125109) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|A9MUE0|KDPB_SALPB Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|B5FNE0|KDPB_SALDC Potassium-transporting ATPase ATP-binding subunit OS=Salmonella dublin (strain CT_02021853) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|B5R670|KDPB_SALG2 Potassium-transporting ATPase ATP-binding subunit OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=kdpB PE=3 SV=1 759 833 1.0E-08
sp|Q324L0|KDPB_SHIBS Potassium-transporting ATPase ATP-binding subunit OS=Shigella boydii serotype 4 (strain Sb227) GN=kdpB PE=3 SV=1 759 833 2.0E-08
sp|O30085|COPB_ARCFU Copper-exporting P-type ATPase B OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copB PE=1 SV=1 759 841 2.0E-08
sp|P9WPU3|KDPB_MYCTU Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kdpB PE=3 SV=1 759 878 2.0E-08
sp|P9WPU2|KDPB_MYCTO Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kdpB PE=3 SV=1 759 878 2.0E-08
sp|P63682|KDPB_MYCBO Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kdpB PE=3 SV=1 759 878 2.0E-08
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 496 846 2.0E-08
sp|A8GB61|KDPB_SERP5 Potassium-transporting ATPase ATP-binding subunit OS=Serratia proteamaculans (strain 568) GN=kdpB PE=3 SV=1 759 833 2.0E-08
sp|A4W860|KDPB_ENT38 Potassium-transporting ATPase ATP-binding subunit OS=Enterobacter sp. (strain 638) GN=kdpB PE=3 SV=1 759 833 2.0E-08
sp|O29777|COPA_ARCFU Probable copper-exporting P-type ATPase A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copA PE=1 SV=1 222 461 3.0E-08
sp|Q4L970|COPA_STAHJ Copper-exporting P-type ATPase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copA PE=3 SV=1 758 819 3.0E-08
sp|P57698|KDPB_PSEAE Potassium-transporting ATPase ATP-binding subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=kdpB PE=3 SV=1 758 866 3.0E-08
sp|O33533|FIXI_RHILV Nitrogen fixation protein FixI OS=Rhizobium leguminosarum bv. viciae GN=fixI PE=3 SV=1 763 845 3.0E-08
sp|P9WPT5|CTPC_MYCTU Probable manganese/zinc-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpC PE=1 SV=1 648 864 3.0E-08
sp|P9WPT4|CTPC_MYCTO Probable manganese/zinc-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpC PE=3 SV=1 648 864 3.0E-08
sp|P0A503|CTPC_MYCBO Probable cation-transporting P-type ATPase C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpC PE=3 SV=1 648 864 3.0E-08
sp|A4SZG8|KDPB_POLSQ Potassium-transporting ATPase ATP-binding subunit OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=kdpB PE=3 SV=1 759 820 3.0E-08
sp|P37386|CADA2_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 199 478 3.0E-08
sp|P73241|ATCS_SYNY3 Probable copper-transporting ATPase PacS OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pacS PE=1 SV=1 222 488 4.0E-08
sp|Q9RZP0|KDPB_DEIRA Potassium-transporting ATPase ATP-binding subunit OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=kdpB PE=3 SV=1 759 833 4.0E-08
sp|Q9X8Z9|KDPB_STRCO Potassium-transporting ATPase ATP-binding subunit OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=kdpB PE=3 SV=3 759 878 4.0E-08
sp|B2TTJ7|KDPB_SHIB3 Potassium-transporting ATPase ATP-binding subunit OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=kdpB PE=3 SV=1 759 833 4.0E-08
sp|P37617|ATZN_ECOLI Lead, cadmium, zinc and mercury-transporting ATPase OS=Escherichia coli (strain K12) GN=zntA PE=1 SV=1 764 847 5.0E-08
sp|P9WPS7|CTPG_MYCTU Probable cation-transporting ATPase G OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpG PE=1 SV=1 210 473 5.0E-08
sp|P9WPS6|CTPG_MYCTO Probable cation-transporting ATPase G OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpG PE=3 SV=1 210 473 5.0E-08
sp|P63690|CTPG_MYCBO Probable cation-transporting ATPase G OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpG PE=3 SV=1 210 473 5.0E-08
sp|P58165|AT2B2_OREMO Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 215 339 7.0E-08
sp|O59666|ATU2_SCHPO Copper-transporting ATPase ccc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccc2 PE=3 SV=1 221 472 9.0E-08
sp|Q47H39|KDPB_DECAR Potassium-transporting ATPase ATP-binding subunit OS=Dechloromonas aromatica (strain RCB) GN=kdpB PE=3 SV=1 759 878 1.0E-07
sp|Q9SZW4|HMA2_ARATH Cadmium/zinc-transporting ATPase HMA2 OS=Arabidopsis thaliana GN=HMA2 PE=2 SV=1 756 874 1.0E-07
sp|Q8CQF7|COPB_STAES Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copB PE=3 SV=1 226 465 2.0E-07
sp|P57700|KDPB_THEAC Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=kdpB PE=3 SV=1 760 867 2.0E-07
sp|Q4LAB1|COPB_STAHJ Probable copper-transporting P-type ATPase B OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copB PE=3 SV=2 226 465 3.0E-07
sp|Q97BF6|KDPB_THEVO Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=kdpB PE=3 SV=1 760 891 3.0E-07
sp|Q9ZHC7|SILP_SALTM Silver exporting P-type ATPase OS=Salmonella typhimurium GN=silP PE=1 SV=1 222 471 4.0E-07
sp|A8YZ02|COPB_STAAT Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copB PE=3 SV=1 226 465 5.0E-07
sp|Q2FKI2|COPB_STAA3 Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300) GN=copB PE=3 SV=1 226 465 5.0E-07
sp|Q5HKB0|COPB_STAEQ Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copB PE=3 SV=2 226 465 6.0E-07
sp|O32219|CADA_BACSU Cadmium, zinc and cobalt-transporting ATPase OS=Bacillus subtilis (strain 168) GN=cadA PE=1 SV=1 758 861 6.0E-07
sp|Q60048|CADA_LISMN Probable cadmium-transporting ATPase OS=Listeria monocytogenes GN=cadA PE=1 SV=1 764 847 6.0E-07
sp|Q9SZC9|HMA6_ARATH Copper-transporting ATPase PAA1, chloroplastic OS=Arabidopsis thaliana GN=PAA1 PE=2 SV=1 141 467 7.0E-07
sp|Q59998|ATZN_SYNY3 Zinc-transporting ATPase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ziaA PE=1 SV=1 204 467 7.0E-07
sp|P9WPS3|CTPV_MYCTU Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpV PE=1 SV=1 203 482 8.0E-07
sp|P9WPS2|CTPV_MYCTO Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpV PE=3 SV=1 203 482 8.0E-07
sp|Q9KPZ7|COPA_VIBCH Copper-exporting P-type ATPase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=copA PE=3 SV=1 221 495 9.0E-07
sp|P37617|ATZN_ECOLI Lead, cadmium, zinc and mercury-transporting ATPase OS=Escherichia coli (strain K12) GN=zntA PE=1 SV=1 199 467 9.0E-07
sp|P58414|CADA_LISMO Probable cadmium-transporting ATPase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cadA PE=3 SV=1 760 847 9.0E-07
sp|Q8ZCA7|COPA_YERPE Copper-exporting P-type ATPase A OS=Yersinia pestis GN=copA PE=3 SV=1 205 482 1.0E-06
sp|Q6GIX1|CADA_STAAR Probable cadmium-transporting ATPase OS=Staphylococcus aureus (strain MRSA252) GN=cadA PE=3 SV=1 648 861 1.0E-06
sp|P20021|CADA1_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 764 861 1.0E-06
sp|P37386|CADA2_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 648 861 1.0E-06
sp|P58414|CADA_LISMO Probable cadmium-transporting ATPase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cadA PE=3 SV=1 223 465 1.0E-06
sp|P18398|FIXI_RHIME Nitrogen fixation protein FixI OS=Rhizobium meliloti (strain 1021) GN=fixI PE=3 SV=1 624 845 1.0E-06
sp|P18398|FIXI_RHIME Nitrogen fixation protein FixI OS=Rhizobium meliloti (strain 1021) GN=fixI PE=3 SV=1 223 458 1.0E-06
sp|Q8PPC9|KDPB_XANAC Potassium-transporting ATPase ATP-binding subunit OS=Xanthomonas axonopodis pv. citri (strain 306) GN=kdpB PE=3 SV=1 759 820 3.0E-06
sp|O32220|COPA_BACSU Copper-exporting P-type ATPase A OS=Bacillus subtilis (strain 168) GN=copA PE=1 SV=2 217 488 4.0E-06
sp|P57700|KDPB_THEAC Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=kdpB PE=3 SV=1 192 647 4.0E-06
sp|Q8PCM1|KDPB_XANCP Potassium-transporting ATPase ATP-binding subunit OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=kdpB PE=3 SV=1 759 820 4.0E-06
sp|Q59207|FIXI_BRADU Nitrogen fixation protein FixI OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fixI PE=3 SV=1 760 845 4.0E-06
sp|P37279|ATCS_SYNE7 Probable copper-transporting ATPase PacS OS=Synechococcus elongatus (strain PCC 7942) GN=pacS PE=3 SV=2 221 465 5.0E-06
sp|Q69HU0|COPB_STAAU Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus GN=copB PE=3 SV=1 226 478 5.0E-06
sp|Q9SZW4|HMA2_ARATH Cadmium/zinc-transporting ATPase HMA2 OS=Arabidopsis thaliana GN=HMA2 PE=2 SV=1 220 464 7.0E-06
sp|Q6GIX4|COPB_STAAR Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain MRSA252) GN=copB PE=3 SV=1 226 478 9.0E-06
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 638 803 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 163 185 22
2 195 217 22
3 361 383 22
4 398 420 22
5 842 864 22
6 869 891 22
7 921 943 22
8 975 997 22
9 1017 1039 22
10 1049 1066 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 1.00 0.19 1.81
CcL In ants, during behavior modification 1.26 0.17 2.35
CcD In ants, recently dead 9.79 4.68 14.90

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 1.000000 no
SC16a CcD 0.000286 yes
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1576
MDLIDDDRSDVEKERGRAIFFDDDAVSARGRRGDGGGAGRSLSQSRFRSRSRGSSRSRAGLPAPSPYSGVQIEYR
SLSMHVAESTRVNNLDNNNNKSQTTTDKEDHDAYFAGLTYHKLSPDDLCQQLNVSRTAGLSDDAAARRLTRDGRN
ALPRAKSNYMAKLAGYLFGGFCSVLWLGVIIFFLCWKPLSNPPSGTNLALALLVLVVIFLQAGFAAFQDWSTRRT
MRAIVDLLPAEALVLREGRREKRDAAQLVAGDVVILRMGDKVPADLRLLSHSGDLRFDRSVLTGEPDEIEAAVDA
TDANILESRNMALMGTLVVNGSGEAVVVLTGSRSVMGRIAKATAAAGQGSTLIQREVWRFVRIIVGLTVVLALVI
LLAWLLWLRRQHAGFMDVVAMLNNVMGCVVAFIPEGMPVAVALTLMRVARRMKAVDVLPKGLSTVETLGCVNVVC
SDKTGTLTQNQMVVSSVACVDKAVAGEEGDDHGEKEAVDDVRLRRAALLCNDAVFDPASLHLPVASRKVQGNATD
AAVLRFAAGAGAEPEKLPRLFQIPFNSSNKWMLTLHDDGGEYRVFVKGAPDVLLPACARYWSRRSGAIEPLTDND
RAAINRYQDLLAGRAERVILLCEKTIRPTHALGSNDFAAEVTDSAVADLTVIGILGIVDPPRPETADTVAACRRA
GARFFMVTGDYGLTAAAIARLTGIFTADRVPDSAETVRAAVEDGNNINEIDDRHSSLLLEGPALPSLLTPAHWDM
VCAYSEVVFARTSPEQKLRIVEELRRRGNVVAVTGDGVNDAPALRAADVGVAVVSGSDVAIEAAHLVLLDRFDSI
VDAIRLGRLVFQNLQKVIAYLLPAGSCSEIWPVLLNVFFGVPLPLSAFLMIIICVFTDLFMSLSLIMEQEEFDLL
SLPPRNHKRDHLINAKIYAQAYLFVGLMETCTAHAMFFLYYWRQARIPVRELFFLYERYTDGFHGYSAAELAHFN
ATGQSVYFVTLVILQWGNILAVRNRRLSILQADPFTTKRRNPWLVLSILISFVIAVFVTEVPAIQNLFNTASVPI
EYWLIPLPLALGLLCMDELRKLLVRLFPKGPLAAIAW
Coding >Ophio5|1576
ATGGATCTCATTGACGACGACAGGTCCGACGTCGAAAAGGAGCGCGGACGGGCCATTTTCTTTGACGACGATGCT
GTCTCGGCAAGGGGCCGTCGAGGTGATGGCGGAGGTGCGGGCCGGTCGCTGTCTCAGAGCCGGTTCCGGTCTCGC
AGTCGAGGCTCTTCGCGATCTCGGGCTGGACTTCCTGCGCCGTCGCCGTACTCGGGTGTACAGATTGAGTATAGG
AGTCTGTCGATGCATGTCGCTGAGTCGACTCGGGTGAATAACTTGGACAACAACAACAACAAGAGTCAAACGACG
ACGGACAAGGAAGATCACGACGCTTACTTTGCTGGCCTGACATATCACAAACTCTCACCGGATGACCTCTGCCAG
CAGCTCAACGTCTCCCGCACGGCTGGCCTTTCGGACGATGCAGCGGCTCGACGACTCACTCGCGATGGACGCAAT
GCCCTTCCGCGGGCCAAGTCGAATTACATGGCCAAGTTAGCAGGCTACCTCTTCGGCGGTTTCTGTTCGGTGCTA
TGGCTCGGCGTCATCATCTTCTTCCTTTGTTGGAAGCCGTTGAGCAATCCTCCTTCGGGCACGAATCTGGCCCTT
GCGTTGCTGGTCCTCGTCGTCATCTTCTTGCAGGCTGGGTTCGCTGCTTTTCAGGATTGGTCGACGCGTAGGACG
ATGCGGGCCATTGTCGATTTGTTACCGGCTGAGGCTTTGGTTCTTCGTGAAGGGAGGAGGGAAAAGAGGGATGCG
GCTCAGCTTGTTGCTGGAGATGTCGTCATCTTGCGCATGGGGGATAAAGTCCCGGCTGACTTGAGGTTGTTGAGC
CACTCGGGCGATCTGCGTTTTGATCGGTCGGTGCTGACGGGTGAGCCGGATGAGATTGAAGCTGCTGTCGATGCT
ACCGATGCTAATATCCTCGAGAGTCGCAACATGGCGCTCATGGGTACGTTGGTGGTGAACGGTTCAGGCGAGGCC
GTTGTCGTTCTCACGGGCTCGCGATCTGTCATGGGTCGAATAGCGAAGGCGACGGCGGCGGCGGGACAAGGCTCA
ACCTTGATCCAGCGCGAGGTCTGGCGCTTCGTCCGCATCATCGTCGGATTGACAGTGGTATTGGCCCTCGTCATT
CTACTGGCGTGGCTATTGTGGCTTCGACGCCAACACGCTGGCTTCATGGACGTGGTGGCGATGCTTAACAATGTC
ATGGGCTGTGTTGTCGCTTTCATACCGGAGGGTATGCCTGTGGCTGTGGCGCTGACGCTGATGAGGGTTGCGAGA
CGGATGAAGGCTGTCGATGTTCTGCCCAAGGGGTTGTCGACGGTCGAGACGCTGGGTTGTGTCAATGTCGTGTGC
TCGGATAAGACGGGCACTCTGACGCAGAACCAGATGGTTGTCAGCTCCGTCGCCTGCGTCGACAAGGCCGTGGCT
GGTGAAGAGGGTGATGACCATGGTGAGAAAGAGGCCGTCGACGATGTCCGTCTTCGCCGCGCTGCTCTACTCTGC
AACGACGCCGTCTTCGACCCGGCATCGCTTCATCTCCCCGTTGCCAGCCGAAAAGTCCAGGGAAACGCCACCGAC
GCCGCCGTCCTCCGCTTCGCCGCCGGAGCCGGAGCCGAGCCGGAGAAGCTACCGCGACTGTTCCAGATTCCCTTC
AACTCGAGCAACAAGTGGATGCTGACGCTTCACGACGACGGAGGCGAATACCGCGTCTTCGTCAAGGGCGCGCCC
GACGTCCTGCTTCCAGCCTGCGCACGATACTGGTCCCGTCGCTCCGGTGCCATCGAGCCCCTGACAGACAACGAC
CGGGCTGCCATCAACCGCTATCAAGACCTGCTCGCTGGACGGGCCGAGCGCGTCATCCTTCTCTGCGAAAAGACG
ATAAGGCCGACGCATGCGCTGGGATCAAATGACTTTGCTGCTGAGGTGACCGACTCCGCCGTCGCAGACCTTACC
GTCATCGGCATCCTCGGCATCGTGGACCCGCCCCGGCCCGAGACTGCCGATACGGTGGCTGCTTGTCGTCGTGCC
GGCGCACGCTTCTTCATGGTTACCGGTGATTACGGGCTTACGGCTGCGGCTATTGCTCGTCTGACTGGCATCTTC
ACCGCCGACCGCGTGCCGGACTCTGCTGAGACGGTCCGGGCTGCTGTCGAGGATGGTAATAACATCAACGAAATC
GACGACCGCCACAGTAGTCTTCTCCTCGAGGGCCCTGCTCTTCCTTCACTACTGACTCCAGCCCACTGGGATATG
GTATGCGCCTACAGCGAGGTCGTCTTCGCCCGCACCTCGCCAGAGCAGAAGCTCCGCATCGTCGAGGAGCTTCGG
CGCCGAGGAAACGTCGTGGCCGTCACGGGAGACGGTGTAAACGACGCTCCCGCTCTTCGTGCCGCTGATGTTGGA
GTCGCCGTCGTCTCTGGAAGCGATGTCGCCATCGAGGCTGCTCATCTTGTCCTGCTCGACCGTTTCGATTCCATC
GTCGATGCTATTCGCCTCGGCCGCCTCGTCTTTCAGAACCTGCAAAAGGTTATTGCCTATCTGCTTCCCGCCGGT
AGTTGCTCCGAGATCTGGCCTGTTCTCCTCAATGTCTTCTTCGGCGTGCCCTTGCCGCTCAGCGCTTTTCTCATG
ATCATCATCTGCGTCTTCACCGACCTTTTCATGTCGCTGTCCCTTATCATGGAACAGGAAGAGTTCGATCTGCTG
TCACTTCCGCCACGTAACCACAAGCGCGATCACCTCATCAATGCAAAGATTTACGCCCAAGCCTATCTCTTCGTC
GGCCTCATGGAGACGTGCACCGCCCATGCCATGTTCTTCCTTTACTACTGGCGCCAGGCACGCATCCCCGTCCGC
GAGCTCTTCTTCCTCTACGAGCGCTATACCGATGGCTTCCACGGCTACAGCGCTGCTGAGCTTGCCCATTTCAAC
GCCACCGGCCAGTCCGTCTACTTCGTCACTCTCGTCATTCTCCAGTGGGGCAACATCCTGGCCGTCCGCAACCGT
CGACTCAGTATTCTTCAGGCTGATCCCTTTACCACTAAGCGGAGGAACCCGTGGCTGGTATTGAGCATCCTTATT
AGTTTCGTCATTGCTGTCTTTGTCACCGAAGTGCCGGCCATCCAGAACCTCTTCAACACCGCCTCGGTGCCCATC
GAATACTGGCTCATTCCCCTGCCACTCGCCCTCGGCCTGCTCTGCATGGACGAGTTGCGCAAGCTGCTCGTTCGT
CTATTTCCCAAGGGGCCACTGGCCGCCATTGCTTGG
Transcript >Ophio5|1576
ATGGATCTCATTGACGACGACAGGTCCGACGTCGAAAAGGAGCGCGGACGGGCCATTTTCTTTGACGACGATGCT
GTCTCGGCAAGGGGCCGTCGAGGTGATGGCGGAGGTGCGGGCCGGTCGCTGTCTCAGAGCCGGTTCCGGTCTCGC
AGTCGAGGCTCTTCGCGATCTCGGGCTGGACTTCCTGCGCCGTCGCCGTACTCGGGTGTACAGATTGAGTATAGG
AGTCTGTCGATGCATGTCGCTGAGTCGACTCGGGTGAATAACTTGGACAACAACAACAACAAGAGTCAAACGACG
ACGGACAAGGAAGATCACGACGCTTACTTTGCTGGCCTGACATATCACAAACTCTCACCGGATGACCTCTGCCAG
CAGCTCAACGTCTCCCGCACGGCTGGCCTTTCGGACGATGCAGCGGCTCGACGACTCACTCGCGATGGACGCAAT
GCCCTTCCGCGGGCCAAGTCGAATTACATGGCCAAGTTAGCAGGCTACCTCTTCGGCGGTTTCTGTTCGGTGCTA
TGGCTCGGCGTCATCATCTTCTTCCTTTGTTGGAAGCCGTTGAGCAATCCTCCTTCGGGCACGAATCTGGCCCTT
GCGTTGCTGGTCCTCGTCGTCATCTTCTTGCAGGCTGGGTTCGCTGCTTTTCAGGATTGGTCGACGCGTAGGACG
ATGCGGGCCATTGTCGATTTGTTACCGGCTGAGGCTTTGGTTCTTCGTGAAGGGAGGAGGGAAAAGAGGGATGCG
GCTCAGCTTGTTGCTGGAGATGTCGTCATCTTGCGCATGGGGGATAAAGTCCCGGCTGACTTGAGGTTGTTGAGC
CACTCGGGCGATCTGCGTTTTGATCGGTCGGTGCTGACGGGTGAGCCGGATGAGATTGAAGCTGCTGTCGATGCT
ACCGATGCTAATATCCTCGAGAGTCGCAACATGGCGCTCATGGGTACGTTGGTGGTGAACGGTTCAGGCGAGGCC
GTTGTCGTTCTCACGGGCTCGCGATCTGTCATGGGTCGAATAGCGAAGGCGACGGCGGCGGCGGGACAAGGCTCA
ACCTTGATCCAGCGCGAGGTCTGGCGCTTCGTCCGCATCATCGTCGGATTGACAGTGGTATTGGCCCTCGTCATT
CTACTGGCGTGGCTATTGTGGCTTCGACGCCAACACGCTGGCTTCATGGACGTGGTGGCGATGCTTAACAATGTC
ATGGGCTGTGTTGTCGCTTTCATACCGGAGGGTATGCCTGTGGCTGTGGCGCTGACGCTGATGAGGGTTGCGAGA
CGGATGAAGGCTGTCGATGTTCTGCCCAAGGGGTTGTCGACGGTCGAGACGCTGGGTTGTGTCAATGTCGTGTGC
TCGGATAAGACGGGCACTCTGACGCAGAACCAGATGGTTGTCAGCTCCGTCGCCTGCGTCGACAAGGCCGTGGCT
GGTGAAGAGGGTGATGACCATGGTGAGAAAGAGGCCGTCGACGATGTCCGTCTTCGCCGCGCTGCTCTACTCTGC
AACGACGCCGTCTTCGACCCGGCATCGCTTCATCTCCCCGTTGCCAGCCGAAAAGTCCAGGGAAACGCCACCGAC
GCCGCCGTCCTCCGCTTCGCCGCCGGAGCCGGAGCCGAGCCGGAGAAGCTACCGCGACTGTTCCAGATTCCCTTC
AACTCGAGCAACAAGTGGATGCTGACGCTTCACGACGACGGAGGCGAATACCGCGTCTTCGTCAAGGGCGCGCCC
GACGTCCTGCTTCCAGCCTGCGCACGATACTGGTCCCGTCGCTCCGGTGCCATCGAGCCCCTGACAGACAACGAC
CGGGCTGCCATCAACCGCTATCAAGACCTGCTCGCTGGACGGGCCGAGCGCGTCATCCTTCTCTGCGAAAAGACG
ATAAGGCCGACGCATGCGCTGGGATCAAATGACTTTGCTGCTGAGGTGACCGACTCCGCCGTCGCAGACCTTACC
GTCATCGGCATCCTCGGCATCGTGGACCCGCCCCGGCCCGAGACTGCCGATACGGTGGCTGCTTGTCGTCGTGCC
GGCGCACGCTTCTTCATGGTTACCGGTGATTACGGGCTTACGGCTGCGGCTATTGCTCGTCTGACTGGCATCTTC
ACCGCCGACCGCGTGCCGGACTCTGCTGAGACGGTCCGGGCTGCTGTCGAGGATGGTAATAACATCAACGAAATC
GACGACCGCCACAGTAGTCTTCTCCTCGAGGGCCCTGCTCTTCCTTCACTACTGACTCCAGCCCACTGGGATATG
GTATGCGCCTACAGCGAGGTCGTCTTCGCCCGCACCTCGCCAGAGCAGAAGCTCCGCATCGTCGAGGAGCTTCGG
CGCCGAGGAAACGTCGTGGCCGTCACGGGAGACGGTGTAAACGACGCTCCCGCTCTTCGTGCCGCTGATGTTGGA
GTCGCCGTCGTCTCTGGAAGCGATGTCGCCATCGAGGCTGCTCATCTTGTCCTGCTCGACCGTTTCGATTCCATC
GTCGATGCTATTCGCCTCGGCCGCCTCGTCTTTCAGAACCTGCAAAAGGTTATTGCCTATCTGCTTCCCGCCGGT
AGTTGCTCCGAGATCTGGCCTGTTCTCCTCAATGTCTTCTTCGGCGTGCCCTTGCCGCTCAGCGCTTTTCTCATG
ATCATCATCTGCGTCTTCACCGACCTTTTCATGTCGCTGTCCCTTATCATGGAACAGGAAGAGTTCGATCTGCTG
TCACTTCCGCCACGTAACCACAAGCGCGATCACCTCATCAATGCAAAGATTTACGCCCAAGCCTATCTCTTCGTC
GGCCTCATGGAGACGTGCACCGCCCATGCCATGTTCTTCCTTTACTACTGGCGCCAGGCACGCATCCCCGTCCGC
GAGCTCTTCTTCCTCTACGAGCGCTATACCGATGGCTTCCACGGCTACAGCGCTGCTGAGCTTGCCCATTTCAAC
GCCACCGGCCAGTCCGTCTACTTCGTCACTCTCGTCATTCTCCAGTGGGGCAACATCCTGGCCGTCCGCAACCGT
CGACTCAGTATTCTTCAGGCTGATCCCTTTACCACTAAGCGGAGGAACCCGTGGCTGGTATTGAGCATCCTTATT
AGTTTCGTCATTGCTGTCTTTGTCACCGAAGTGCCGGCCATCCAGAACCTCTTCAACACCGCCTCGGTGCCCATC
GAATACTGGCTCATTCCCCTGCCACTCGCCCTCGGCCTGCTCTGCATGGACGAGTTGCGCAAGCTGCTCGTTCGT
CTATTTCCCAAGGGGCCACTGGCCGCCATTGCTTGGTGA
Gene >Ophio5|1576
ATGGATCTCATTGACGACGACAGGTCCGACGTCGAAAAGGAGCGCGGACGGGCCATTTTCTTTGACGACGATGCT
GTCTCGGCAAGGGGCCGTCGAGGTGATGGCGGAGGTGCGGGCCGGTCGCTGTCTCAGAGCCGGTTCCGGTCTCGC
AGTCGAGGCTCTTCGCGATCTCGGGCTGGACTTCCTGCGCCGTCGCCGTACTCGGGTGTACAGATTGAGTATAGG
AGTCTGTCGATGCATGTCGCTGAGTCGACTCGGGTGAATAACTTGGACAACAACAACAACAAGAGTCAAACGACG
ACGGACAAGGAAGATCACGACGCTTACTTTGCTGGCCTGACATATCACAAACTCTCACCGGATGACCTCTGCCAG
CAGCTCAACGTCTCCCGCACGGCTGGCCTTTCGGACGATGCAGCGGCTCGACGACTCACTCGCGATGGACGCAAT
GCCCTTCCGCGGGCCAAGTCGAATTACATGGCCAAGTTAGCAGGCTACCTCTTCGGCGGTTTCTGTTCGGTGCTA
TGGCTCGGCGTCATCATCTTCTTCCTTTGTTGGAAGCCGTTGAGCAATCCTCCTTCGGGCACGAATCTGGCCCTT
GCGTTGCTGGTCCTCGTCGTCATCTTCTTGCAGGCTGGGTTCGCTGCTTTTCAGGATTGGTCGACGCGTAGGACG
ATGCGGGCCATTGTCGATTTGTTACCGGCTGAGGCTTTGGTTCTTCGTGAAGGGAGGAGGGAAAAGAGGGATGCG
GCTCAGCTTGTTGCTGGAGATGTCGTCATCTTGCGCATGGGGGATAAAGTCCCGGCTGACTTGAGGTTGTTGAGC
CACTCGGGCGATCTGCGTTTTGATCGGTCGGTGCTGACGGGTGAGCCGGATGAGATTGAAGCTGCTGTCGATGCT
ACCGATGCTAATATCCTCGAGAGTCGCAACATGGCGCTCATGGGTACGTTGGTGGTGAACGGTTCAGGCGAGGCC
GTTGTCGTTCTCACGGGCTCGCGATCTGTCATGGGTCGAATAGCGAAGGCGACGGCGGCGGCGGGACAAGGCTCA
ACCTTGATCCAGCGCGAGGTCTGGCGCTTCGTCCGCATCATCGTCGGATTGACAGTGGTATTGGCCCTCGTCATT
CTACTGGCGTGGCTATTGTGGCTTCGACGCCAACACGCTGGCTTCATGGACGTGGTGGCGATGCTTAACAATGTC
ATGGGCTGTGTTGTCGCTTTCATACCGGAGGGTATGCCTGTGGCTGTGGCGCTGACGCTGATGAGGGTTGCGAGA
CGGATGAAGGCTGTCGATGTTCTGCCCAAGGGGTTGTCGACGGTCGAGACGCTGGGTTGTGTCAATGTCGTGTGC
TCGGATAAGACGGGCACTCTGACGCAGAACCAGATGGTTGTCAGCTCCGTCGCCTGCGTCGACAAGGCCGTGGCT
GGTGAAGAGGGTGATGACCATGGTGAGAAAGAGGCCGTCGACGATGTCCGTCTTCGCCGCGCTGCTCTACTCTGC
AACGACGCCGTCTTCGACCCGGCATCGCTTCATCTCCCCGTTGCCAGCCGAAAAGTCCAGGGAAACGCCACCGAC
GCCGCCGTCCTCCGCTTCGCCGCCGGAGCCGGAGCCGAGCCGGAGAAGCTACCGCGACTGTTCCAGATTCCCTTC
AACTCGAGCAACAAGTGGATGCTGACGCTTCACGACGACGGAGGCGAATACCGCGTCTTCGTCAAGGGCGCGCCC
GACGTCCTGCTTCCAGCCTGCGCACGATACTGGTCCCGTCGCTCCGGTGCCATCGAGCCCCTGACAGACAACGAC
CGGGCTGCCATCAACCGCTATCAAGACCTGCTCGCTGGACGGGCCGAGCGCGTCATCCTTCTCTGCGAAAAGACG
ATAAGGCCGACGCATGCGCTGGGATCAAATGACTTTGCTGCTGAGGTGACCGACTCCGCCGTCGCAGACCTTACC
GTCATCGGCATCCTCGGCATCGTGGACCCGCCCCGGCCCGAGACTGCCGATACGGTGGCTGCTTGTCGTCGTGCC
GGCGCACGCTTCTTCATGGTTACCGGTGATTACGGGCTTACGGCTGCGGCTATTGCTCGTCTGACTGGCATCTTC
ACCGCCGACCGCGTGCCGGACTCTGCTGAGACGGTCCGGGCTGCTGTCGAGGATGGTAATAACATCAACGAAATC
GACGACCGCCACAGTAGTCTTCTCCTCGAGGGCCCTGCTCTTCCTTCACTACTGACTCCAGCCCACTGGGATATG
GTATGCGCCTACAGCGAGGTCGTCTTCGCCCGCACCTCGCCAGAGCAGAAGCTCCGCATCGTCGAGGAGCTTCGG
CGCCGAGGAAACGTCGTGGCCGTCACGGGAGACGGTGTAAACGACGCTCCCGCTCTTCGTGCCGCTGATGTTGGA
GTCGCCGTCGTCTCTGGAAGCGATGTCGCCATCGAGGCTGCTCATCTTGTCCTGCTCGACCGTTTCGATTCCATC
GTCGATGCTATTCGCCTCGGCCGCCTCGTCTTTCAGAACCTGCAAAAGGTTATTGCCTATCTGCTTCCCGCCGGT
AGTTGCTCCGAGATCTGGCCTGTTCTCCTCAATGTCTTCTTCGGCGTGCCCTTGCCGCTCAGCGCTTTTCTCATG
ATCATCATCTGCGTCTTCACCGACCTTTTCATGTCGCTGTCCCTTATCATGGAACAGGAAGAGTTCGATCTGCTG
TCACTTCCGCCACGTAACCACAAGCGCGATCACCTCATCAATGCAAAGATTTACGCCCAAGCCTATCTCTTCGTC
GGCCTCATGGAGACGTGCACCGCCCATGCCATGTTCTTCCTTTACTACTGGCGCCAGGCACGCATCCCCGTCCGC
GAGCTCTTCTTCCTCTACGAGCGCTATACCGATGGCTTCCACGGCTACAGCGCTGCTGAGCTTGCCCATTTCAAC
GCCACCGGCCAGTCCGTCTACTTCGTCACTCTCGTCATTCTCCAGTGGGGCAACATCCTGGCCGTCCGCAACCGT
CGACTCAGTATTCTTCAGGCTGATCCCTTTACCACTAAGCGGAGGAACCCGTGGCTGGTATTGAGCATCCTTATT
AGTTTCGTCATTGCTGTCTTTGTCACCGAAGTGCCGGCCATCCAGAACCTCTTCAACACCGCCTCGGTGCCCATC
GAATACTGGCTCATTCCCCTGCCACTCGCCCTCGGCCTGCTCTGCATGGACGAGTTGCGCAAGCTGCTCGTTCGT
CTATTTCCCAAGGGGCCACTGGCCGCCATTGCTTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail