Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1570
Gene name
Locationscaffold_1565:66..1321
Strand-
Gene length (bp)1255
Transcript length (bp)999
Coding sequence length (bp)996
Protein length (aa) 332

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 109 279 3.0E-06

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5131 0.2873 0.1411 0.1552 0.3105 0.3967 0.3538 0.3636 0.5393 0.2051

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup781
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|501
Ophiocordyceps australis map64 (Brazil) OphauB2|3062
Ophiocordyceps camponoti-floridani Ophcf2|00878
Ophiocordyceps camponoti-rufipedis Ophun1|5296
Ophiocordyceps kimflemingae Ophio5|1570 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2972

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1570
MGKFKVPSWLQPAADGKKLNRRSFSGFSSQRRLKHESLPVGKASSPPPPPPPTPPPSSRLMELAAKITVETEKLD
SYVREKGLQEPGFAVDAPDTFPPLPPHLQTSRLEVVCAAQELESLIRGPRESVRWAAWSYLDTLSLQIINNYGIA
QLVPLDRPMPLSQLQTKTTLDATNLARVLRHAMTKHVFCEISPGLIGHTAASRLLAHDESLQDWVGFNSEDVFPA
AAHALEALKAYPEATSLTTTGFNFAFDTVGKEPMFVTFGKDPQRARRMGGAMASLSGGEGYEVSHFVDSYDLTDV
DARAGTFVDRAAAHLRGPVCRGSDPIATARLF
Coding >Ophio5|1570
ATGGGCAAGTTCAAGGTGCCTTCATGGCTACAACCGGCAGCCGACGGCAAGAAGCTGAACCGTCGATCCTTTTCC
GGCTTTTCTTCTCAGCGGAGACTCAAGCACGAGAGTCTGCCAGTGGGCAAGGCTTCTTCGCCGCCGCCTCCGCCG
CCGCCAACACCACCGCCATCATCCCGTCTGATGGAGCTTGCTGCCAAGATCACGGTGGAAACGGAGAAGCTGGAT
AGCTATGTGAGGGAAAAGGGTTTACAGGAACCGGGATTTGCCGTCGATGCTCCCGATACCTTCCCGCCTTTACCA
CCGCATCTGCAGACGAGCAGACTTGAGGTGGTGTGTGCCGCTCAGGAGCTTGAGAGTCTGATTCGAGGACCGCGC
GAGAGCGTGAGATGGGCCGCCTGGAGCTATCTCGATACGTTGAGTCTTCAGATCATCAACAACTACGGCATCGCT
CAACTCGTTCCCCTGGACCGACCCATGCCGCTTTCGCAACTACAGACCAAGACGACTCTAGACGCCACCAACCTC
GCTCGCGTGCTACGGCACGCCATGACGAAGCACGTCTTCTGCGAAATCTCACCGGGACTCATCGGCCACACGGCA
GCATCTCGCCTGCTAGCTCACGACGAGTCGTTGCAAGACTGGGTGGGCTTCAACTCGGAGGACGTATTCCCGGCA
GCGGCACACGCGCTAGAAGCGCTGAAAGCGTATCCGGAAGCGACATCGCTGACGACGACGGGCTTCAACTTCGCC
TTCGACACGGTGGGCAAGGAGCCCATGTTCGTGACGTTTGGAAAGGATCCCCAACGGGCCAGACGGATGGGCGGC
GCCATGGCTAGCCTCTCCGGCGGAGAGGGCTACGAGGTCAGCCACTTCGTCGACAGCTACGACCTGACCGACGTC
GACGCCAGGGCCGGCACCTTTGTCGATCGCGCCGCGGCCCATCTGCGAGGACCCGTCTGTCGCGGCTCGGATCCG
ATTGCAACAGCACGACTTTTT
Transcript >Ophio5|1570
ATGGGCAAGTTCAAGGTGCCTTCATGGCTACAACCGGCAGCCGACGGCAAGAAGCTGAACCGTCGATCCTTTTCC
GGCTTTTCTTCTCAGCGGAGACTCAAGCACGAGAGTCTGCCAGTGGGCAAGGCTTCTTCGCCGCCGCCTCCGCCG
CCGCCAACACCACCGCCATCATCCCGTCTGATGGAGCTTGCTGCCAAGATCACGGTGGAAACGGAGAAGCTGGAT
AGCTATGTGAGGGAAAAGGGTTTACAGGAACCGGGATTTGCCGTCGATGCTCCCGATACCTTCCCGCCTTTACCA
CCGCATCTGCAGACGAGCAGACTTGAGGTGGTGTGTGCCGCTCAGGAGCTTGAGAGTCTGATTCGAGGACCGCGC
GAGAGCGTGAGATGGGCCGCCTGGAGCTATCTCGATACGTTGAGTCTTCAGATCATCAACAACTACGGCATCGCT
CAACTCGTTCCCCTGGACCGACCCATGCCGCTTTCGCAACTACAGACCAAGACGACTCTAGACGCCACCAACCTC
GCTCGCGTGCTACGGCACGCCATGACGAAGCACGTCTTCTGCGAAATCTCACCGGGACTCATCGGCCACACGGCA
GCATCTCGCCTGCTAGCTCACGACGAGTCGTTGCAAGACTGGGTGGGCTTCAACTCGGAGGACGTATTCCCGGCA
GCGGCACACGCGCTAGAAGCGCTGAAAGCGTATCCGGAAGCGACATCGCTGACGACGACGGGCTTCAACTTCGCC
TTCGACACGGTGGGCAAGGAGCCCATGTTCGTGACGTTTGGAAAGGATCCCCAACGGGCCAGACGGATGGGCGGC
GCCATGGCTAGCCTCTCCGGCGGAGAGGGCTACGAGGTCAGCCACTTCGTCGACAGCTACGACCTGACCGACGTC
GACGCCAGGGCCGGCACCTTTGTCGATCGCGCCGCGGCCCATCTGCGAGGACCCGTCTGTCGCGGCTCGGATCCG
ATTGCAACAGCACGACTTTTTTGA
Gene >Ophio5|1570
ATGGGCAAGTTCAAGGTGCCTTCATGGCTACAACCGGCAGCCGACGGCAAGAAGCTGAACCGTCGATCCTTTTCC
GGCTTTTCTTCTCAGCGGAGACTCAAGCACGAGAGTCTGCCAGTGGGCAAGGCTTCTTCGCCGCCGCCTCCGCCG
CCGCCAACACCACCGCCATCATCCCGTCTGATGGAGCTTGCTGCCAAGATCACGGTGGAAACGGAGAAGCTGGAT
AGCTATGTGAGGGAAAAGGGTTTACAGGAACCGGGATTTGCCGTCGATGCTCCCGATACCTTCCCGCCTTTACCA
CCGCATCTGCAGACGAGCAGACTTGAGGTGGTGTGTGCCGCTCAGGAGCTTGAGAGTCTGATTCGAGGACCGCGC
GAGAGCGTGAGATGGGCCGCCTGGAGCGTACGTTTTGGGTCTCGGTTTCCCCCCCCCGCCCCCCCCCTTTGGGTT
GTGTGCGCGGGTACGCTGATGCTAAAAGGTTGTAGTATCTCGATACGTTGAGTCTTCAGATCATCAACAACTACG
GCATCGGTACGTGCTTTTTTTTGTTGTTTTCGATGAAGCCAAGAATGAAGTGAGAAGCTAAAGAAGGGGGACAAA
AATAACCAGCTCAACTCGTTCCCCTGGACCGACCCATGCCGCTTTCGCAACTACAGACCAAGACGACTCTAGACG
CCACCAACCTCGCTCGCGTGCTACGGCACGCCATGACGAAGCACGTCTTCTGCGAAATCTCACCGGGACTCATCG
GCCACACGGCAGCATCTCGCCTGCTAGCTCACGACGAGTCGTTGCAAGACTGGGTGGGCTTCAACTCGGAGGACG
TATTCCCGGCAGCGGCACACGCGCTAGAAGCGCTGAAAGCGTATCCGGAAGCGACATCGCTGACGACGACGGGCT
TCAACTTCGCCTTCGACACGGTGGGCAAGGAGCCCATGTTCGTGACGTTTGGAAAGGATCCCCAACGGGCCAGAC
GGATGGGCGGCGCCATGGCTAGCCTCTCCGGCGGAGAGGGCTACGAGGTCAGCCACTTCGTCGACAGCTACGACC
TGACCGACGTCGACGCCAGGGCCGGCACCTTTGTCGATGTAGGCGGTAGTCATGGCTTCGTCTGCGTCGACCTCG
CCAAGAAGTGGAAGCGCATGTCTTTTGTCGTACAAGATCTGGCCAAGACGGTCGATAGCGCGCCGCGGCCCATCT
GCGAGGACCCGTCTGTCGCGGCTCGGATCCGATTGCAACAGCACGACTTTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail