Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1555
Gene name
Locationscaffold_156:5753..7231
Strand-
Gene length (bp)1478
Transcript length (bp)471
Coding sequence length (bp)468
Protein length (aa) 156

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1269 0.9632 0.1895 0.0546 0.0587 0.0156 0.021 0.0035 0.0177 0.0002

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup264
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4823
Ophiocordyceps australis 1348a (Ghana) OphauG2|4824
Ophiocordyceps australis map64 (Brazil) OphauB2|3299
Ophiocordyceps australis map64 (Brazil) OphauB2|3300
Ophiocordyceps camponoti-floridani Ophcf2|06695
Ophiocordyceps camponoti-floridani Ophcf2|06696
Ophiocordyceps camponoti-rufipedis Ophun1|6321
Ophiocordyceps kimflemingae Ophio5|1555 (this protein)
Ophiocordyceps kimflemingae Ophio5|1556
Ophiocordyceps subramaniannii Hirsu2|10758
Ophiocordyceps subramaniannii Hirsu2|10759

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1555
MAPKAASLWEKPDFLVDVVCALYEVADLTPETKQMVEGFLRGEGHEISWDAIRQHVQKLRRNRDTNALSRGNSVT
PTKAAAGGKKKAATKRAKQELTPADDDDDDEMKVLKREVDDDVDEVEVKTPKKKRVKREIKKEPSPVDGEAADDE
ANSGEV
Coding >Ophio5|1555
ATGGCGCCCAAGGCTGCGAGTCTCTGGGAGAAGCCGGATTTCCTCGTCGATGTTGTCTGCGCCCTGTATGAGGTT
GCCGACTTGACGCCGGAGACGAAGCAGATGGTGGAGGGGTTTTTGCGTGGCGAGGGCCATGAGATCTCTTGGGAT
GCGATTCGTCAGCATGTCCAAAAGTTGCGACGTAACAGGGACACGAACGCCCTTAGCAGAGGGAACTCTGTCACT
CCCACCAAGGCCGCGGCTGGCGGCAAGAAAAAGGCCGCGACCAAGCGGGCTAAGCAGGAGTTGACCCCCGCCGAC
GACGACGACGACGACGAGATGAAAGTCCTCAAACGGGAGGTCGACGACGATGTGGATGAGGTTGAAGTCAAAACG
CCCAAGAAAAAACGTGTCAAGCGGGAGATTAAAAAGGAGCCCTCTCCTGTCGATGGTGAGGCGGCCGACGACGAG
GCCAACAGCGGCGAAGTT
Transcript >Ophio5|1555
ATGGCGCCCAAGGCTGCGAGTCTCTGGGAGAAGCCGGATTTCCTCGTCGATGTTGTCTGCGCCCTGTATGAGGTT
GCCGACTTGACGCCGGAGACGAAGCAGATGGTGGAGGGGTTTTTGCGTGGCGAGGGCCATGAGATCTCTTGGGAT
GCGATTCGTCAGCATGTCCAAAAGTTGCGACGTAACAGGGACACGAACGCCCTTAGCAGAGGGAACTCTGTCACT
CCCACCAAGGCCGCGGCTGGCGGCAAGAAAAAGGCCGCGACCAAGCGGGCTAAGCAGGAGTTGACCCCCGCCGAC
GACGACGACGACGACGAGATGAAAGTCCTCAAACGGGAGGTCGACGACGATGTGGATGAGGTTGAAGTCAAAACG
CCCAAGAAAAAACGTGTCAAGCGGGAGATTAAAAAGGAGCCCTCTCCTGTCGATGGTGAGGCGGCCGACGACGAG
GCCAACAGCGGCGAAGTTTAG
Gene >Ophio5|1555
ATGGCGCCCAAGGCTGCGAGTCTCTGGGAGAAGCCGGATTTCCTCGTCGATGTTGTCTGCGCCCTGTATGAGGTT
GCCGACTTGACGCCGGAGACGAAGCAGATGGTGGAGGGGTTTTTGCGTGGCGAGGGCCATGAGATCTCTTGGGAT
GCGATTCGGTAGGTGGTTTTTCATTTCGGTTTTCTCTGTCTCTTTTTTTTTTTTTTTTACTTTCTTATTGTCTTG
AACTCGTGCCCTATCTTTCTCTTATCTGCTTCTTTCTTCTTCTCTTCTCTTCTTCTTTTACTCTCTTCCCCCTCT
TCTTCCTCTTTCTCTCTTTCTGTGTCATCCACATCCCCGCTCATCTCCTCACTCCGCCTCTCTCCACGACTTCTC
CATCTCTTCCCTCACCACTTCCCTCACCATTCATCGACCGTGACAACTCTGTTTTCTTCGCCCTCTTCGTCGCCT
CTCCCTCGTCTCTTTCCGCATCTCGAGCCATGGCAAACCGCCAGTTGATGAAGTGGACCCCAGAGGTTCATGAGG
ATATCCTCCTTGCCATGTTCCAGCACGTCACAATCTCGCCCGGTGACTACGAGAAGCTCATGGACGAGCTGCGAG
CCCATGGCTATACTTTTAGCGAGAGTGCTCTACGGTCAGCTATCTTGCTATTTACCCGTTTTTCCCGCCACCTGA
TTTTTTTTTTTTCGGGCTGTTCTCCCTATGCCTACTTATCCGCCCACGCCCCCCCCTCCCCGCTGTCAGCTGGCT
TTCTACGACTCGTTTTTACTCTTTTCACGCCTTCATCGCGCCTTTTTCTTCTCATCATCTTCTATCCTGTTCATT
TGCTCGAGTTTTCTCGTCAACAGCCATCATCCATCCTCTTTTTGCCCCTTCACTATCCTCATGGCTGGCAAAGCT
ACCCGAGGCTGGGATGCTACATCCCACGAGGCTCTCCTACTTTGTCTTATTGATGAGGTCAAGCCTAGCAAGGCT
TTGATCACGTCAGTCACTGAGAGGATGAAAGAGGCCGGCTACACGTACTCTTATGATGCAATCAAGTGATTATCG
TCCTTGATCCACACGGTCTATATCTGGCAACATGAAAGCTAATGTATGTGTTTGTTATAGTCAGCATGTCCAAAA
GTTGCGACGTAACAGGGACACGAACGCCCTTAGCAGAGGGAACTCTGTCACTCCCACCAAGGCCGCGGCTGGCGG
CAAGAAAAAGGCCGCGACCAAGCGGGCTAAGCAGGAGTTGACCCCCGCCGACGACGACGACGACGACGAGATGAA
AGTCCTCAAACGGGAGGTCGACGACGATGTGGATGAGGTTGAAGTCAAAACGCCCAAGAAAAAACGTGTCAAGCG
GGAGATTAAAAAGGAGCCGTAAGTTTCTTGTACGCCTACTACCATGTTTCCCCCGCTTACGCTTGAAACTCAGCT
CTCCTGTCGATGGTGAGGCGGCCGACGACGAGGCCAACAGCGGCGAAGTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail