Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1553
Gene name
Locationscaffold_156:2761..4008
Strand+
Gene length (bp)1247
Transcript length (bp)1083
Coding sequence length (bp)1080
Protein length (aa) 360

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03152 UFD1 Ubiquitin fusion degradation protein UFD1 6.7E-47 68 190

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53044|UFD1_YEAST Ubiquitin fusion degradation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UFD1 PE=1 SV=1 27 344 6.0E-76
sp|O42915|UFD1_SCHPO Ubiquitin fusion degradation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ufd1 PE=2 SV=4 5 337 2.0E-71
sp|Q9VTF9|UFD1_DROME Ubiquitin fusion degradation protein 1 homolog OS=Drosophila melanogaster GN=Ufd1-like PE=2 SV=1 30 273 2.0E-51
sp|Q92890|UFD1_HUMAN Ubiquitin fusion degradation protein 1 homolog OS=Homo sapiens GN=UFD1L PE=1 SV=3 26 333 8.0E-49
sp|Q9ES53|UFD1_RAT Ubiquitin fusion degradation protein 1 homolog OS=Rattus norvegicus GN=Ufd1l PE=1 SV=1 26 333 1.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53044|UFD1_YEAST Ubiquitin fusion degradation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UFD1 PE=1 SV=1 27 344 6.0E-76
sp|O42915|UFD1_SCHPO Ubiquitin fusion degradation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ufd1 PE=2 SV=4 5 337 2.0E-71
sp|Q9VTF9|UFD1_DROME Ubiquitin fusion degradation protein 1 homolog OS=Drosophila melanogaster GN=Ufd1-like PE=2 SV=1 30 273 2.0E-51
sp|Q92890|UFD1_HUMAN Ubiquitin fusion degradation protein 1 homolog OS=Homo sapiens GN=UFD1L PE=1 SV=3 26 333 8.0E-49
sp|Q9ES53|UFD1_RAT Ubiquitin fusion degradation protein 1 homolog OS=Rattus norvegicus GN=Ufd1l PE=1 SV=1 26 333 1.0E-47
sp|P70362|UFD1_MOUSE Ubiquitin fusion degradation protein 1 homolog OS=Mus musculus GN=Ufd1l PE=1 SV=2 26 333 1.0E-47
sp|Q55BK0|UFD1_DICDI Ubiquitin fusion degradation protein 1 homolog OS=Dictyostelium discoideum GN=ufd1 PE=3 SV=1 31 191 7.0E-39
sp|Q19584|UFD1_CAEEL Ubiquitin fusion degradation protein 1 homolog OS=Caenorhabditis elegans GN=ufd-1 PE=3 SV=1 32 329 4.0E-34
[Show less]

GO

GO Term Description Terminal node
GO:0006511 ubiquitin-dependent protein catabolic process Yes
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006508 proteolysis No
GO:0019941 modification-dependent protein catabolic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0019538 protein metabolic process No
GO:0009056 catabolic process No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0044248 cellular catabolic process No
GO:0009057 macromolecule catabolic process No
GO:1901575 organic substance catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043632 modification-dependent macromolecule catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1553
MYSGFGGGYDPTNPDHLYNLARHGRRNLTQRFDEYYRCYPVIMAPGAVRPDLNYGSKIILPPSALDKGKHSHAGV
LEFIAEEGRAYIPQWMLETLEMDVGDMIQIRTTSLELAKMVKLQPQSVSFLEISDPRAVLERAFRNFATLTKGDV
FSFEYNDEVFQVAVLDVKPETDKMGVSMIETDVSVEFAPPLGYVEPERKSGTSTPRSTRGGIPAGGLVHSQGTMA
QAINYSAIAPSATGSTTSFLGEGQRLAKKGSKNTTPKPATPVPAETIAVSKRPTGTAPAPLRLAPNKLFFGYEIK
PVKTVEDKIKEREEAERPHFAGQGQNLRGTAKRKGNGDDKSKAPDKKGTGEGRRRDDGGP
Coding >Ophio5|1553
ATGTACTCCGGCTTCGGCGGCGGCTATGACCCGACCAACCCAGACCACCTATACAACCTGGCCCGCCATGGCCGA
CGAAACTTGACGCAGCGCTTCGATGAGTACTACAGATGCTATCCCGTCATCATGGCTCCAGGCGCCGTGCGTCCG
GACCTCAACTACGGCTCCAAGATCATCCTTCCGCCGTCGGCTCTGGACAAGGGGAAGCACTCTCATGCCGGTGTG
CTTGAGTTCATCGCAGAAGAGGGACGTGCCTACATCCCGCAATGGATGCTGGAGACGCTCGAGATGGACGTGGGA
GACATGATACAGATCCGGACAACATCGCTCGAGCTGGCCAAGATGGTCAAGCTGCAGCCGCAGTCGGTCAGCTTC
CTCGAAATCAGCGATCCGCGAGCCGTTCTCGAGAGGGCATTTAGGAACTTTGCCACTCTCACGAAAGGCGACGTC
TTCAGCTTTGAGTACAACGACGAGGTCTTCCAAGTGGCCGTCTTGGACGTCAAGCCGGAGACGGACAAGATGGGC
GTCAGCATGATCGAGACGGACGTGTCAGTCGAATTCGCTCCTCCGCTCGGGTACGTCGAGCCCGAGAGGAAAAGC
GGGACGAGCACGCCGCGCAGCACCCGCGGCGGTATCCCGGCCGGGGGCCTCGTCCACAGCCAGGGGACCATGGCT
CAGGCCATCAACTACAGCGCCATCGCCCCGTCCGCCACAGGCAGCACCACGAGCTTCCTCGGCGAGGGTCAGCGT
CTCGCCAAAAAGGGCAGCAAGAATACGACGCCTAAGCCGGCCACACCGGTGCCAGCCGAGACCATCGCCGTGTCC
AAGCGGCCAACAGGCACGGCACCGGCGCCGCTGCGGCTGGCCCCGAATAAGCTCTTCTTCGGATACGAGATCAAA
CCCGTCAAGACGGTCGAGGACAAGATTAAGGAGAGAGAGGAAGCCGAGAGGCCTCACTTTGCCGGCCAAGGGCAA
AATCTCCGCGGTACAGCCAAGAGGAAGGGGAATGGGGACGACAAGTCCAAGGCACCGGACAAAAAAGGAACTGGG
GAGGGCCGTCGACGGGACGATGGTGGGCCA
Transcript >Ophio5|1553
ATGTACTCCGGCTTCGGCGGCGGCTATGACCCGACCAACCCAGACCACCTATACAACCTGGCCCGCCATGGCCGA
CGAAACTTGACGCAGCGCTTCGATGAGTACTACAGATGCTATCCCGTCATCATGGCTCCAGGCGCCGTGCGTCCG
GACCTCAACTACGGCTCCAAGATCATCCTTCCGCCGTCGGCTCTGGACAAGGGGAAGCACTCTCATGCCGGTGTG
CTTGAGTTCATCGCAGAAGAGGGACGTGCCTACATCCCGCAATGGATGCTGGAGACGCTCGAGATGGACGTGGGA
GACATGATACAGATCCGGACAACATCGCTCGAGCTGGCCAAGATGGTCAAGCTGCAGCCGCAGTCGGTCAGCTTC
CTCGAAATCAGCGATCCGCGAGCCGTTCTCGAGAGGGCATTTAGGAACTTTGCCACTCTCACGAAAGGCGACGTC
TTCAGCTTTGAGTACAACGACGAGGTCTTCCAAGTGGCCGTCTTGGACGTCAAGCCGGAGACGGACAAGATGGGC
GTCAGCATGATCGAGACGGACGTGTCAGTCGAATTCGCTCCTCCGCTCGGGTACGTCGAGCCCGAGAGGAAAAGC
GGGACGAGCACGCCGCGCAGCACCCGCGGCGGTATCCCGGCCGGGGGCCTCGTCCACAGCCAGGGGACCATGGCT
CAGGCCATCAACTACAGCGCCATCGCCCCGTCCGCCACAGGCAGCACCACGAGCTTCCTCGGCGAGGGTCAGCGT
CTCGCCAAAAAGGGCAGCAAGAATACGACGCCTAAGCCGGCCACACCGGTGCCAGCCGAGACCATCGCCGTGTCC
AAGCGGCCAACAGGCACGGCACCGGCGCCGCTGCGGCTGGCCCCGAATAAGCTCTTCTTCGGATACGAGATCAAA
CCCGTCAAGACGGTCGAGGACAAGATTAAGGAGAGAGAGGAAGCCGAGAGGCCTCACTTTGCCGGCCAAGGGCAA
AATCTCCGCGGTACAGCCAAGAGGAAGGGGAATGGGGACGACAAGTCCAAGGCACCGGACAAAAAAGGAACTGGG
GAGGGCCGTCGACGGGACGATGGTGGGCCATAA
Gene >Ophio5|1553
ATGGTACGCAATCCGTCCGCTACTCTCAGCGAAATCTGACAGAGTGTCTAGTACTCCGGCTTCGGCGGCGGCTAT
GACCCGACCAACCCAGACCACCTATACAACCTGGCCCGCCATGGCCGACGAAACTTGACGCAGCGCTTCGATGAG
TACTACAGATGCTATCCCGTCATCATGGCTCCAGGCGCCGTGCGTCCGGACCTCAACTACGGCTCCAAGATCATC
CTTCCGCCGTCGGCTCTGGACAAGGTCTCCAAGCTCCACGTCCAGTGGCCTCTTTTGATGGAGATGATTAACGGC
GAAAAGGGGAAGCACTCTCATGCCGGTGTGCTTGAGTTCATCGCAGAAGAGGGACGTGCCTACATCCCGCAATGG
GTTCGTTATATCCGATTCCCTTACTGAACTGGCCCTCAAGCTGACCAGAGCGCGGGCAGATGCTGGAGACGCTCG
AGATGGACGTGGGAGACATGATACAGATCCGGACAACATCGCTCGAGCTGGCCAAGATGGTCAAGCTGCAGCCGC
AGTCGGTCAGCTTCCTCGAAATCAGCGATCCGCGAGCCGTTCTCGAGAGGGCATTTAGGAACTTTGCCACTCTCA
CGAAAGGCGACGTCTTCAGCTTTGAGTACAACGACGAGGTCTTCCAAGTGGCCGTCTTGGACGTCAAGCCGGAGA
CGGACAAGATGGGCGTCAGCATGATCGAGACGGACGTGTCAGTCGAATTCGCTCCTCCGCTCGGGTACGTCGAGC
CCGAGAGGAAAAGCGGGACGAGCACGCCGCGCAGCACCCGCGGCGGTATCCCGGCCGGGGGCCTCGTCCACAGCC
AGGGGACCATGGCTCAGGCCATCAACTACAGCGCCATCGCCCCGTCCGCCACAGGCAGCACCACGAGCTTCCTCG
GCGAGGGTCAGCGTCTCGCCAAAAAGGGCAGCAAGAATACGACGCCTAAGCCGGCCACACCGGTGCCAGCCGAGA
CCATCGCCGTGTCCAAGCGGCCAACAGGCACGGCACCGGCGCCGCTGCGGCTGGCCCCGAATAAGCTCTTCTTCG
GATACGAGATCAAACCCGTCAAGACGGTCGAGGACAAGATTAAGGAGAGAGAGGAAGCCGAGAGGCCTCACTTTG
CCGGCCAAGGGCAAAATCTCCGCGGTACAGCCAAGAGGAAGGGGAATGGGGACGACAAGTCCAAGGCACCGGACA
AAAAAGGAACTGGGGAGGGCCGTCGACGGGACGATGGTGGGCCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail