Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1537
Gene name
Locationscaffold_155:12658..15490
Strand-
Gene length (bp)2832
Transcript length (bp)2832
Coding sequence length (bp)2829
Protein length (aa) 943

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03835 Rad4 Rad4 transglutaminase-like domain 1.0E-28 465 604
PF10405 BHD_3 Rad4 beta-hairpin domain 3 3.9E-27 746 818
PF10403 BHD_1 Rad4 beta-hairpin domain 1 5.5E-19 616 673
PF10404 BHD_2 Rad4 beta-hairpin domain 2 2.1E-15 677 739

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 464 861 3.0E-76
sp|Q10445|RHP41_SCHPO DNA repair protein rhp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp41 PE=3 SV=1 96 861 7.0E-58
sp|Q24595|XPC_DROME DNA repair protein complementing XP-C cells homolog OS=Drosophila melanogaster GN=Xpc PE=1 SV=2 463 861 9.0E-34
sp|Q01831|XPC_HUMAN DNA repair protein complementing XP-C cells OS=Homo sapiens GN=XPC PE=1 SV=4 474 915 1.0E-32
sp|P14736|RAD4_YEAST DNA repair protein RAD4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD4 PE=1 SV=3 468 881 2.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 464 861 3.0E-76
sp|Q10445|RHP41_SCHPO DNA repair protein rhp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp41 PE=3 SV=1 96 861 7.0E-58
sp|Q24595|XPC_DROME DNA repair protein complementing XP-C cells homolog OS=Drosophila melanogaster GN=Xpc PE=1 SV=2 463 861 9.0E-34
sp|Q01831|XPC_HUMAN DNA repair protein complementing XP-C cells OS=Homo sapiens GN=XPC PE=1 SV=4 474 915 1.0E-32
sp|P14736|RAD4_YEAST DNA repair protein RAD4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD4 PE=1 SV=3 468 881 2.0E-30
sp|P51612|XPC_MOUSE DNA repair protein complementing XP-C cells homolog OS=Mus musculus GN=Xpc PE=1 SV=2 474 861 3.0E-28
sp|Q8W489|RAD4_ARATH DNA repair protein RAD4 OS=Arabidopsis thaliana GN=RAD4 PE=1 SV=1 466 862 3.0E-21
sp|Q06665|RAD34_YEAST DNA repair protein RAD34 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD34 PE=1 SV=1 456 873 3.0E-12
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 145 369 3.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3726 0.8797 0.0406 0.0309 0.1732 0.014 0.056 0.0241 0.0403 0.0169

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3560
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|55
Ophiocordyceps australis map64 (Brazil) OphauB2|5918
Ophiocordyceps camponoti-floridani Ophcf2|03086
Ophiocordyceps camponoti-rufipedis Ophun1|2042
Ophiocordyceps kimflemingae Ophio5|1537 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6836

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1537
MSPRVLRKRPRDSPQQNIKGKGKAAPATPAPARKKPKTSLYDDLDASVTPKSGKDSGSTAQRFNLEDSDSSLTSL
SDLDVEDVPAKEAQSKTRESEDDDEDDDIEFEDVAAPNVAAEETPVISGDLELTLRKDTRISLTNPYGDKKGPSK
RERKVRNATHCVHVMLLLWHNAVRNSWLCDPEVQATMLSHIPTRIWNDIERWRRSSGLSTSAETRDATNDTGKRG
TKASSSSDHASRDWGSAAKKLEEGAVDMSCGDPLFRLMQSLVAWWKQRYRVTAPGLRKRGYMALERLDRLTKAFE
AERGEGALFGERILSLEAFRDRARFCQGSRDVGAQLFTALLRGMGLEARMVANLPCLGFGWNKLEDADPEKEEDR
DIHTAEKKATEKPAASAAKSKQMSRSSHAGKKREPQQARNATRNLRRSAPKAIDTEDELRVEDSDSDDELEAEML
LQRYGGTAKPVVQLDKDLEYPHYWSEVLSPVTNKYLAVDSTVKGTIATNRDLVESFEPRGAKADRARQVMAYIVG
YSQDGTAKDVTVRYLKRRVLPGRTKGVRMPSEKVAVYDSHGKVKRHEQLDWFKTAMSGYRRGDKRHPLTDVDHDE
DATDLKPAEAVKKEVKEGEETLQYYKQSREFVLERHLKREEALKEGAAPIKVFRNKAKGGKTEEEDVFLRVDVVQ
VKSAETWHKQGRAPKAGEQPLKRVPYRAATLNRRREIVEAEAATGEKVLQGLFSLEQTDWIIPPPIQDGVIPKND
YGNIDLFAEHMCPEGAVHIPYRGAVRVCKRLGVDFAEAVVGFEFGNRMAVPVIQGVVVAVEHRERVMEELASDEA
QRARREDEKRRKAALGKWRRFIMGLRIAERIRLDYGTIEDKAAPHDDEDMAGGFLPEGFEEDKADEAGHDRSSFF
PVGGEDEDEEEEEEGDGGLTMEDGGSAATEQDDGKRRRRRTRR
Coding >Ophio5|1537
ATGAGTCCTCGAGTATTGCGCAAGCGTCCGCGCGATTCGCCGCAGCAAAATATCAAGGGAAAAGGCAAGGCGGCG
CCTGCAACTCCGGCACCGGCTCGCAAGAAGCCGAAGACTAGTCTGTATGACGATCTCGACGCCTCTGTCACGCCC
AAATCAGGCAAAGATTCTGGCTCCACGGCTCAGCGCTTCAATCTCGAAGACAGCGACAGTTCCTTGACTTCTCTG
TCGGACCTGGATGTGGAAGATGTGCCTGCAAAGGAGGCTCAGTCCAAGACTCGGGAGTCGGAAGACGACGACGAA
GATGACGACATCGAATTTGAGGACGTTGCGGCGCCGAATGTCGCCGCAGAAGAGACACCCGTCATCTCGGGAGAC
CTCGAACTGACGCTACGAAAAGACACGCGCATCTCGCTGACCAACCCTTATGGTGACAAAAAGGGCCCATCCAAG
AGGGAGCGCAAAGTGCGAAACGCCACGCACTGCGTGCACGTCATGCTACTGCTGTGGCACAACGCCGTGCGCAAC
TCGTGGCTCTGCGATCCGGAGGTCCAGGCCACGATGCTATCCCACATCCCAACCAGGATCTGGAACGACATTGAG
CGCTGGAGACGCAGCTCTGGCTTGAGTACATCGGCCGAGACCCGCGACGCTACCAATGACACGGGAAAGCGCGGC
ACCAAAGCCAGCAGCTCGTCTGACCACGCATCGCGCGACTGGGGCTCAGCGGCCAAGAAGCTCGAGGAGGGCGCC
GTGGACATGAGCTGCGGAGACCCTCTCTTCCGCCTTATGCAGTCGCTTGTCGCTTGGTGGAAGCAGCGGTATCGC
GTTACGGCTCCTGGGCTGAGGAAACGGGGCTACATGGCGCTGGAGCGGCTGGACAGGCTGACCAAGGCGTTTGAG
GCTGAGCGAGGGGAGGGTGCCCTCTTCGGTGAGAGGATATTGAGCCTTGAGGCTTTTCGCGATCGCGCTCGTTTC
TGTCAGGGGAGTCGTGACGTTGGAGCGCAGCTGTTCACTGCGCTTCTAAGAGGAATGGGCCTCGAAGCTCGCATG
GTGGCCAACCTCCCGTGCTTAGGGTTTGGATGGAACAAGTTGGAGGATGCGGACCCTGAAAAGGAGGAAGACCGA
GATATTCATACGGCGGAGAAGAAAGCAACGGAGAAGCCGGCGGCGAGTGCAGCGAAGTCGAAGCAAATGTCGAGA
TCTTCGCATGCCGGTAAAAAGAGGGAGCCACAGCAGGCTCGTAACGCAACTCGGAACTTACGTCGTTCAGCTCCA
AAGGCGATCGACACCGAGGACGAACTGCGTGTGGAAGACAGCGATTCCGACGACGAGTTAGAGGCAGAGATGCTG
CTCCAACGGTACGGCGGAACGGCGAAACCAGTAGTCCAACTGGACAAGGACCTCGAATATCCTCACTACTGGTCC
GAAGTGCTGTCACCTGTAACGAACAAGTATCTTGCGGTCGACTCCACGGTCAAGGGCACCATCGCAACGAATCGA
GACCTCGTCGAGTCCTTTGAGCCCCGGGGCGCCAAGGCTGACAGGGCGAGGCAGGTCATGGCCTACATCGTCGGC
TACTCGCAGGACGGGACGGCCAAGGACGTGACGGTGCGGTACCTGAAGCGACGAGTTCTGCCCGGGCGGACCAAA
GGCGTGAGAATGCCGTCGGAAAAGGTTGCCGTCTACGACAGCCACGGCAAGGTGAAGCGGCACGAGCAGCTGGAC
TGGTTCAAGACGGCCATGTCGGGGTACAGGCGAGGCGACAAACGGCATCCGCTCACAGACGTCGACCACGACGAG
GATGCGACGGATCTCAAGCCGGCCGAGGCTGTGAAGAAAGAGGTCAAGGAAGGGGAGGAGACGCTACAGTACTAC
AAGCAATCGCGCGAGTTTGTGCTAGAGAGGCACCTGAAGCGTGAGGAGGCTCTCAAGGAGGGAGCGGCGCCAATC
AAGGTGTTCCGGAACAAGGCCAAGGGCGGCAAGACGGAAGAAGAAGACGTCTTCCTCCGGGTCGACGTGGTCCAG
GTCAAGAGCGCGGAGACGTGGCACAAGCAGGGCAGAGCGCCCAAGGCGGGCGAGCAGCCACTGAAGAGGGTCCCC
TACCGAGCCGCGACGCTGAACCGGCGGAGGGAGATTGTCGAGGCAGAGGCGGCGACGGGGGAAAAGGTGCTTCAG
GGGCTATTTAGCCTGGAGCAGACGGACTGGATTATCCCGCCGCCCATCCAGGACGGAGTGATTCCGAAGAACGAC
TACGGGAACATTGACCTGTTCGCGGAGCACATGTGCCCCGAAGGCGCGGTGCACATCCCCTATCGGGGCGCGGTT
CGGGTATGCAAGCGGCTAGGGGTGGACTTCGCCGAGGCGGTAGTAGGCTTCGAATTCGGAAACCGGATGGCGGTA
CCGGTGATACAGGGTGTCGTCGTGGCAGTCGAGCACCGCGAGCGGGTCATGGAGGAACTGGCCAGCGACGAGGCG
CAGAGGGCACGACGCGAGGACGAAAAGCGACGCAAGGCGGCGCTCGGGAAGTGGCGCAGGTTCATCATGGGGCTA
CGCATCGCGGAGCGGATCCGGCTCGACTATGGCACCATCGAGGATAAGGCGGCTCCGCACGACGACGAGGACATG
GCTGGTGGATTCCTTCCGGAGGGCTTTGAGGAGGACAAGGCGGACGAGGCTGGACATGATCGGTCTAGCTTCTTC
CCGGTGGGGGGTGAGGATGAGGATGAGGAGGAGGAGGAGGAGGGTGATGGCGGCCTCACCATGGAAGATGGAGGC
AGTGCTGCCACGGAGCAAGATGATGGAAAGCGACGGCGACGACGGACTCGTCGT
Transcript >Ophio5|1537
ATGAGTCCTCGAGTATTGCGCAAGCGTCCGCGCGATTCGCCGCAGCAAAATATCAAGGGAAAAGGCAAGGCGGCG
CCTGCAACTCCGGCACCGGCTCGCAAGAAGCCGAAGACTAGTCTGTATGACGATCTCGACGCCTCTGTCACGCCC
AAATCAGGCAAAGATTCTGGCTCCACGGCTCAGCGCTTCAATCTCGAAGACAGCGACAGTTCCTTGACTTCTCTG
TCGGACCTGGATGTGGAAGATGTGCCTGCAAAGGAGGCTCAGTCCAAGACTCGGGAGTCGGAAGACGACGACGAA
GATGACGACATCGAATTTGAGGACGTTGCGGCGCCGAATGTCGCCGCAGAAGAGACACCCGTCATCTCGGGAGAC
CTCGAACTGACGCTACGAAAAGACACGCGCATCTCGCTGACCAACCCTTATGGTGACAAAAAGGGCCCATCCAAG
AGGGAGCGCAAAGTGCGAAACGCCACGCACTGCGTGCACGTCATGCTACTGCTGTGGCACAACGCCGTGCGCAAC
TCGTGGCTCTGCGATCCGGAGGTCCAGGCCACGATGCTATCCCACATCCCAACCAGGATCTGGAACGACATTGAG
CGCTGGAGACGCAGCTCTGGCTTGAGTACATCGGCCGAGACCCGCGACGCTACCAATGACACGGGAAAGCGCGGC
ACCAAAGCCAGCAGCTCGTCTGACCACGCATCGCGCGACTGGGGCTCAGCGGCCAAGAAGCTCGAGGAGGGCGCC
GTGGACATGAGCTGCGGAGACCCTCTCTTCCGCCTTATGCAGTCGCTTGTCGCTTGGTGGAAGCAGCGGTATCGC
GTTACGGCTCCTGGGCTGAGGAAACGGGGCTACATGGCGCTGGAGCGGCTGGACAGGCTGACCAAGGCGTTTGAG
GCTGAGCGAGGGGAGGGTGCCCTCTTCGGTGAGAGGATATTGAGCCTTGAGGCTTTTCGCGATCGCGCTCGTTTC
TGTCAGGGGAGTCGTGACGTTGGAGCGCAGCTGTTCACTGCGCTTCTAAGAGGAATGGGCCTCGAAGCTCGCATG
GTGGCCAACCTCCCGTGCTTAGGGTTTGGATGGAACAAGTTGGAGGATGCGGACCCTGAAAAGGAGGAAGACCGA
GATATTCATACGGCGGAGAAGAAAGCAACGGAGAAGCCGGCGGCGAGTGCAGCGAAGTCGAAGCAAATGTCGAGA
TCTTCGCATGCCGGTAAAAAGAGGGAGCCACAGCAGGCTCGTAACGCAACTCGGAACTTACGTCGTTCAGCTCCA
AAGGCGATCGACACCGAGGACGAACTGCGTGTGGAAGACAGCGATTCCGACGACGAGTTAGAGGCAGAGATGCTG
CTCCAACGGTACGGCGGAACGGCGAAACCAGTAGTCCAACTGGACAAGGACCTCGAATATCCTCACTACTGGTCC
GAAGTGCTGTCACCTGTAACGAACAAGTATCTTGCGGTCGACTCCACGGTCAAGGGCACCATCGCAACGAATCGA
GACCTCGTCGAGTCCTTTGAGCCCCGGGGCGCCAAGGCTGACAGGGCGAGGCAGGTCATGGCCTACATCGTCGGC
TACTCGCAGGACGGGACGGCCAAGGACGTGACGGTGCGGTACCTGAAGCGACGAGTTCTGCCCGGGCGGACCAAA
GGCGTGAGAATGCCGTCGGAAAAGGTTGCCGTCTACGACAGCCACGGCAAGGTGAAGCGGCACGAGCAGCTGGAC
TGGTTCAAGACGGCCATGTCGGGGTACAGGCGAGGCGACAAACGGCATCCGCTCACAGACGTCGACCACGACGAG
GATGCGACGGATCTCAAGCCGGCCGAGGCTGTGAAGAAAGAGGTCAAGGAAGGGGAGGAGACGCTACAGTACTAC
AAGCAATCGCGCGAGTTTGTGCTAGAGAGGCACCTGAAGCGTGAGGAGGCTCTCAAGGAGGGAGCGGCGCCAATC
AAGGTGTTCCGGAACAAGGCCAAGGGCGGCAAGACGGAAGAAGAAGACGTCTTCCTCCGGGTCGACGTGGTCCAG
GTCAAGAGCGCGGAGACGTGGCACAAGCAGGGCAGAGCGCCCAAGGCGGGCGAGCAGCCACTGAAGAGGGTCCCC
TACCGAGCCGCGACGCTGAACCGGCGGAGGGAGATTGTCGAGGCAGAGGCGGCGACGGGGGAAAAGGTGCTTCAG
GGGCTATTTAGCCTGGAGCAGACGGACTGGATTATCCCGCCGCCCATCCAGGACGGAGTGATTCCGAAGAACGAC
TACGGGAACATTGACCTGTTCGCGGAGCACATGTGCCCCGAAGGCGCGGTGCACATCCCCTATCGGGGCGCGGTT
CGGGTATGCAAGCGGCTAGGGGTGGACTTCGCCGAGGCGGTAGTAGGCTTCGAATTCGGAAACCGGATGGCGGTA
CCGGTGATACAGGGTGTCGTCGTGGCAGTCGAGCACCGCGAGCGGGTCATGGAGGAACTGGCCAGCGACGAGGCG
CAGAGGGCACGACGCGAGGACGAAAAGCGACGCAAGGCGGCGCTCGGGAAGTGGCGCAGGTTCATCATGGGGCTA
CGCATCGCGGAGCGGATCCGGCTCGACTATGGCACCATCGAGGATAAGGCGGCTCCGCACGACGACGAGGACATG
GCTGGTGGATTCCTTCCGGAGGGCTTTGAGGAGGACAAGGCGGACGAGGCTGGACATGATCGGTCTAGCTTCTTC
CCGGTGGGGGGTGAGGATGAGGATGAGGAGGAGGAGGAGGAGGGTGATGGCGGCCTCACCATGGAAGATGGAGGC
AGTGCTGCCACGGAGCAAGATGATGGAAAGCGACGGCGACGACGGACTCGTCGTTGA
Gene >Ophio5|1537
ATGAGTCCTCGAGTATTGCGCAAGCGTCCGCGCGATTCGCCGCAGCAAAATATCAAGGGAAAAGGCAAGGCGGCG
CCTGCAACTCCGGCACCGGCTCGCAAGAAGCCGAAGACTAGTCTGTATGACGATCTCGACGCCTCTGTCACGCCC
AAATCAGGCAAAGATTCTGGCTCCACGGCTCAGCGCTTCAATCTCGAAGACAGCGACAGTTCCTTGACTTCTCTG
TCGGACCTGGATGTGGAAGATGTGCCTGCAAAGGAGGCTCAGTCCAAGACTCGGGAGTCGGAAGACGACGACGAA
GATGACGACATCGAATTTGAGGACGTTGCGGCGCCGAATGTCGCCGCAGAAGAGACACCCGTCATCTCGGGAGAC
CTCGAACTGACGCTACGAAAAGACACGCGCATCTCGCTGACCAACCCTTATGGTGACAAAAAGGGCCCATCCAAG
AGGGAGCGCAAAGTGCGAAACGCCACGCACTGCGTGCACGTCATGCTACTGCTGTGGCACAACGCCGTGCGCAAC
TCGTGGCTCTGCGATCCGGAGGTCCAGGCCACGATGCTATCCCACATCCCAACCAGGATCTGGAACGACATTGAG
CGCTGGAGACGCAGCTCTGGCTTGAGTACATCGGCCGAGACCCGCGACGCTACCAATGACACGGGAAAGCGCGGC
ACCAAAGCCAGCAGCTCGTCTGACCACGCATCGCGCGACTGGGGCTCAGCGGCCAAGAAGCTCGAGGAGGGCGCC
GTGGACATGAGCTGCGGAGACCCTCTCTTCCGCCTTATGCAGTCGCTTGTCGCTTGGTGGAAGCAGCGGTATCGC
GTTACGGCTCCTGGGCTGAGGAAACGGGGCTACATGGCGCTGGAGCGGCTGGACAGGCTGACCAAGGCGTTTGAG
GCTGAGCGAGGGGAGGGTGCCCTCTTCGGTGAGAGGATATTGAGCCTTGAGGCTTTTCGCGATCGCGCTCGTTTC
TGTCAGGGGAGTCGTGACGTTGGAGCGCAGCTGTTCACTGCGCTTCTAAGAGGAATGGGCCTCGAAGCTCGCATG
GTGGCCAACCTCCCGTGCTTAGGGTTTGGATGGAACAAGTTGGAGGATGCGGACCCTGAAAAGGAGGAAGACCGA
GATATTCATACGGCGGAGAAGAAAGCAACGGAGAAGCCGGCGGCGAGTGCAGCGAAGTCGAAGCAAATGTCGAGA
TCTTCGCATGCCGGTAAAAAGAGGGAGCCACAGCAGGCTCGTAACGCAACTCGGAACTTACGTCGTTCAGCTCCA
AAGGCGATCGACACCGAGGACGAACTGCGTGTGGAAGACAGCGATTCCGACGACGAGTTAGAGGCAGAGATGCTG
CTCCAACGGTACGGCGGAACGGCGAAACCAGTAGTCCAACTGGACAAGGACCTCGAATATCCTCACTACTGGTCC
GAAGTGCTGTCACCTGTAACGAACAAGTATCTTGCGGTCGACTCCACGGTCAAGGGCACCATCGCAACGAATCGA
GACCTCGTCGAGTCCTTTGAGCCCCGGGGCGCCAAGGCTGACAGGGCGAGGCAGGTCATGGCCTACATCGTCGGC
TACTCGCAGGACGGGACGGCCAAGGACGTGACGGTGCGGTACCTGAAGCGACGAGTTCTGCCCGGGCGGACCAAA
GGCGTGAGAATGCCGTCGGAAAAGGTTGCCGTCTACGACAGCCACGGCAAGGTGAAGCGGCACGAGCAGCTGGAC
TGGTTCAAGACGGCCATGTCGGGGTACAGGCGAGGCGACAAACGGCATCCGCTCACAGACGTCGACCACGACGAG
GATGCGACGGATCTCAAGCCGGCCGAGGCTGTGAAGAAAGAGGTCAAGGAAGGGGAGGAGACGCTACAGTACTAC
AAGCAATCGCGCGAGTTTGTGCTAGAGAGGCACCTGAAGCGTGAGGAGGCTCTCAAGGAGGGAGCGGCGCCAATC
AAGGTGTTCCGGAACAAGGCCAAGGGCGGCAAGACGGAAGAAGAAGACGTCTTCCTCCGGGTCGACGTGGTCCAG
GTCAAGAGCGCGGAGACGTGGCACAAGCAGGGCAGAGCGCCCAAGGCGGGCGAGCAGCCACTGAAGAGGGTCCCC
TACCGAGCCGCGACGCTGAACCGGCGGAGGGAGATTGTCGAGGCAGAGGCGGCGACGGGGGAAAAGGTGCTTCAG
GGGCTATTTAGCCTGGAGCAGACGGACTGGATTATCCCGCCGCCCATCCAGGACGGAGTGATTCCGAAGAACGAC
TACGGGAACATTGACCTGTTCGCGGAGCACATGTGCCCCGAAGGCGCGGTGCACATCCCCTATCGGGGCGCGGTT
CGGGTATGCAAGCGGCTAGGGGTGGACTTCGCCGAGGCGGTAGTAGGCTTCGAATTCGGAAACCGGATGGCGGTA
CCGGTGATACAGGGTGTCGTCGTGGCAGTCGAGCACCGCGAGCGGGTCATGGAGGAACTGGCCAGCGACGAGGCG
CAGAGGGCACGACGCGAGGACGAAAAGCGACGCAAGGCGGCGCTCGGGAAGTGGCGCAGGTTCATCATGGGGCTA
CGCATCGCGGAGCGGATCCGGCTCGACTATGGCACCATCGAGGATAAGGCGGCTCCGCACGACGACGAGGACATG
GCTGGTGGATTCCTTCCGGAGGGCTTTGAGGAGGACAAGGCGGACGAGGCTGGACATGATCGGTCTAGCTTCTTC
CCGGTGGGGGGTGAGGATGAGGATGAGGAGGAGGAGGAGGAGGGTGATGGCGGCCTCACCATGGAAGATGGAGGC
AGTGCTGCCACGGAGCAAGATGATGGAAAGCGACGGCGACGACGGACTCGTCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail